Buuey is using an unsupported spec.
Druid restoration healing for player Buuey is not currently supported.
close

SimulationCraft 710-01

for World of Warcraft 7.1.0 Live (wow build level 22882, git build 375fc9d)

Current simulator hotfixes

Horrific Appendages

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-09 In-game testing shows that the actual rppm is much closer to 1.3~ than 0.7, so we slightly underestimated down to 1.25.
Horrific Appendages rppm 1.25 0.70

Hunter

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 Instincts of the mongoose effect increased from 10% to 20%
(effect#1) base_value 0.00 0.00 Verification Failure (10.00)

Mark of the Hidden Satyr

Tag Spell / Effect Field Hotfixed Value DBC Value
2016-10-10 In-game testing shows that the damage from this ability is roughly 10% higher than what spelldata shows.
Mark of the Hidden Satyr (effect#1) average 29.13 26.49

Table of Contents

Raid Summary

 

Raid Event List
0 adds,count=5,first=20,cooldown=30,duration=20,last=300
1 movement,first=20,cooldown=30,distance=25,last=300
2 movement,players_only=1,first=12,cooldown=16,distance=8

Actions per Minute / DPS Variance Summary

DPS Scale Factors (dps increase per unit stat)

Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mortwraith - 17.93 - 11.28 13.33 11.72 12.98 wowhead
Táunks - 16.92 - 11.55 8.61 7.91 12.57 wowhead
Illistan - -0.32 - -0.49 -0.82 -0.58 -0.81 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Madarii - - 8.78 7.09 12.78 4.52 7.60 wowhead
Oinkie - 9.45 - 6.18 7.30 4.04 6.77 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Rothlandra - 11.90 - 10.50 11.64 14.04 10.41 wowhead
Sarkul - 13.34 - 11.48 10.91 12.68 11.77 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Mellarene - - 10.55 11.06 13.91 6.16 9.11 wowhead
Morepyro - - 8.84 5.14 5.31 3.97 6.74 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Zipi 12.00 - - 10.33 20.41 6.36 10.62 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Faelik - - 13.59 15.21 12.32 13.31 10.96 wowhead
Raji - - 10.94 9.53 10.36 8.01 8.72 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Vait - 13.58 - 7.77 7.14 5.38 9.02 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Bowflexn - 15.62 - 11.26 13.22 16.98 12.09 wowhead
Profile Str Agi Int Crit Haste Mastery Vers wowhead
Alacastria -0.08 - - -0.11 -0.27 -0.12 -0.19 wowhead
Mortwraith

Mortwraith : 550813 dps, 258356 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
550813.1 550813.1 805.8 / 0.146% 149092.1 / 27.1% 40556.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.5 13.5 Fury 2.31% 61.4 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Prepared (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Chaos Blades (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • alchemy: 4
  • herbalism: 82
Scale Factors for Mortwraith Damage Per Second
Agi Haste Vers Mastery Crit
Scale Factors 17.93 13.33 12.98 11.72 11.28
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.03 1.02 1.02 1.02 1.01
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Vers > Mastery ~= Crit
Pawn string ( Pawn: v1: "Mortwraith": Agility=17.93, CritRating=11.28, HasteRating=13.33, MasteryRating=11.72, Versatility=12.98 )

Scale Factors for other metrics

Scale Factors for Mortwraith Damage Per Second
Agi Haste Vers Mastery Crit
Scale Factors 17.93 13.33 12.98 11.72 11.28
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.03 1.02 1.02 1.02 1.01
Gear Ranking
Optimizers
Ranking
  • Agi > Haste ~= Vers > Mastery ~= Crit
Pawn string ( Pawn: v1: "Mortwraith": Agility=17.93, CritRating=11.28, HasteRating=13.33, MasteryRating=11.72, Versatility=12.98 )
Scale Factors for Mortwraith Priority Target Damage Per Second
Agi Vers Crit Mastery Haste
Scale Factors 7.79 6.06 6.00 5.65 4.87
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.18 0.18 0.17 0.18 0.18
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Mortwraith": Agility=7.79, CritRating=6.00, HasteRating=4.87, MasteryRating=5.65, Versatility=6.06 )
Scale Factors for Mortwraith Damage Per Second (Effective)
Agi Haste Vers Mastery Crit
Scale Factors 17.93 13.33 12.98 11.72 11.28
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Mastery > Crit
Pawn string ( Pawn: v1: "Mortwraith": Agility=17.93, CritRating=11.28, HasteRating=13.33, MasteryRating=11.72, Versatility=12.98 )
Scale Factors for Mortwraith Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for Mortwraith Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )
Scale Factors for MortwraithTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mortwraith": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Mortwraith 550813
Annihilation 20368 3.7% 18.2 16.04sec 442170 457864 Direct 36.4 152641 333162 221085 37.9% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.20 36.39 0.00 0.00 0.9657 0.0000 8046043.33 8046043.33 0.00 457863.96 457863.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.59 62.08% 152641.28 101753 195531 152683.90 137790 172419 3448696 3448696 0.00
crit 13.80 37.92% 333161.89 221821 426258 333184.33 0 383871 4597348 4597348 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 7006 1.3% 115.0 3.36sec 24433 11738 Direct 115.0 20529 41066 24432 38.0% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.98 114.98 0.00 0.00 2.0815 0.0000 2809368.41 4130037.68 31.98 11737.93 11737.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.48 43.04% 20529.41 18309 23081 20528.65 19533 21529 1015873 1493429 31.98
crit 43.67 37.98% 41066.16 36619 46162 41066.68 39090 43306 1793496 2636608 31.98
miss 21.83 18.98% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 3502 0.6% 115.0 3.36sec 12215 5868 Direct 115.0 10265 20535 12215 37.9% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 114.98 114.98 0.00 0.00 2.0815 0.0000 1404532.41 2064795.68 31.98 5868.33 5868.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.55 43.09% 10265.28 9155 11541 10265.12 9772 10786 508606 747699 31.98
crit 43.63 37.94% 20534.82 18309 23081 20534.81 19531 21543 895927 1317097 31.98
miss 21.81 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 47195 8.5% 18.0 15.80sec 1034140 760001 Direct 414.2 32610 65190 44979 38.0% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.02 414.21 0.00 0.00 1.3607 0.0000 18630654.87 27388827.40 31.98 760000.61 760000.61
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 256.96 62.04% 32610.18 17040 90155 32615.36 28891 36290 8379466 12318609 31.98
crit 157.25 37.96% 65189.73 34079 180311 65203.12 55335 76570 10251189 15070218 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Blades (chaos_blade_mh) 10524 1.9% 21.3 16.77sec 196943 124327 Direct 21.3 142604 285124 196943 38.1% 0.0%  

Stats details: chaos_blade_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.30 21.30 0.00 0.00 1.5841 0.0000 4195539.69 4195539.69 0.00 124327.02 124327.02
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.18 61.87% 142603.57 126507 151809 142612.22 130122 151809 1879634 1879634 0.00
crit 8.12 38.13% 285123.59 253015 303618 285094.97 0 303618 2315906 2315906 0.00
 
 

Action details: chaos_blade_mh

Static Values
  • id:211796
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211796
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Blades (chaos_blade_oh) 5251 1.0% 21.3 16.77sec 98247 62022 Direct 21.3 71293 142592 98249 37.8% 0.0%  

Stats details: chaos_blade_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.30 21.30 0.00 0.00 1.5841 0.0000 2092996.24 2092996.24 0.00 62022.05 62022.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.25 62.19% 71292.54 63254 75904 71296.46 64835 75904 944591 944591 0.00
crit 8.05 37.81% 142591.86 126507 151809 142607.03 126507 151809 1148406 1148406 0.00
 
 

Action details: chaos_blade_oh

Static Values
  • id:211797
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:211797
  • name:Chaos Blades
  • school:chaos
  • tooltip:
  • description:Attack with pure Fel power, dealing Chaos damage equal to {$s1=3}% off-hand weapon damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.00
 
Chaos Strike 59930 11.1% 81.4 4.52sec 297191 217321 Direct 162.7 102720 223909 148687 37.9% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.40 162.71 0.00 0.00 1.3675 0.0000 24192337.40 24192337.40 0.00 217320.52 217320.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.99 62.07% 102720.16 78271 150619 102641.32 97483 107710 10373734 10373734 0.00
crit 61.72 37.93% 223909.49 170631 328350 223757.80 207694 242037 13818604 13818604 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 22268 4.0% 5.4 55.98sec 1635724 1617019 Direct 123.0 51801 103628 71480 38.0% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.37 122.97 0.00 0.00 1.0117 0.0000 8790117.41 12922305.21 31.98 1617019.39 1617019.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.28 62.03% 51800.59 25382 134294 51647.76 35506 61517 3951413 5808952 31.98
crit 46.69 37.97% 103628.28 50764 268588 103302.01 65135 139575 4838704 7113353 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon's Bite 17864 3.3% 94.7 4.19sec 75449 58690 Direct 94.7 54651 109339 75449 38.0% 0.0%  

Stats details: demons_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 94.67 94.67 0.00 0.00 1.2855 0.0000 7143061.63 10500977.20 31.98 58690.16 58690.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.67 61.97% 54651.28 47493 73113 54680.92 51743 57412 3206377 4713678 31.98
crit 36.00 38.03% 109339.42 94986 146227 109396.83 102052 118990 3936684 5787299 31.98
 
 

Action details: demons_bite

Static Values
  • id:162243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
Spelldata
  • id:162243
  • name:Demon's Bite
  • school:physical
  • tooltip:
  • description:Quickly attack for $sw2 Physical damage. |cFFFFFFFFGenerates $m3 to $M3 Fury.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.60
 
Eye Beam 68880 (98184) 12.5% (17.8%) 11.8 32.71sec 3285687 1681673 Periodic 553.2 0 49277 49277 100.0% 0.0% 4.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.83 0.00 111.17 553.21 1.9539 0.1750 27260202.93 27260202.93 0.00 1681672.55 1681672.55
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 553.2 100.00% 49276.94 43920 67614 49276.43 44863 53722 27260203 27260203 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 29304 5.3% 0.0 0.00sec 0 0 Direct 57.7 145817 291753 201128 37.9% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 57.67 0.00 0.00 0.0000 0.0000 11599886.45 11599886.45 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.82 62.10% 145816.65 13534 208348 145427.78 98647 168393 5222559 5222559 0.00
crit 21.86 37.90% 291752.95 27068 416696 290958.98 197941 337063 6377327 6377327 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Rush 57350 10.4% 34.9 11.65sec 650637 1610672 Direct 121.9 135189 270390 186500 38.0% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.93 121.88 0.00 0.00 0.4040 0.0000 22729807.51 22729807.51 0.00 1610672.30 1610672.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.62 62.05% 135189.40 129316 199076 135167.79 129420 141418 10223422 10223422 0.00
crit 46.25 37.95% 270390.40 258632 398153 270342.55 258632 287263 12506386 12506386 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 49950 (79898) 9.0% (14.5%) 7.1 60.60sec 4472870 3506884 Periodic 448.6 31941 63890 44081 38.0% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 0.00 49.34 448.57 1.2756 0.4283 19773150.57 19773150.57 0.00 1048901.91 3506884.16
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 278.1 62.00% 31941.26 17325 53342 31941.43 27918 35631 8883710 8883710 0.00
crit 170.4 38.00% 63890.32 34650 106684 63888.43 54796 72915 10889440 10889440 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Rage of the Illidari 29948 5.4% 7.0 60.60sec 1687102 0 Direct 32.0 370644 0 370644 0.0% 0.0%  

Stats details: rage_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.03 31.99 0.00 0.00 0.0000 0.0000 11855437.67 11855437.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.99 100.00% 370643.83 218293 2528401 370732.71 317721 537253 11855438 11855438 0.00
 
 

Action details: rage_of_the_illidari

Static Values
  • id:217070
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:217070
  • name:Rage of the Illidari
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:349438.54
  • base_dd_max:349438.54
 
Mark of the Hidden Satyr 4711 0.9% 22.2 18.07sec 85065 0 Direct 22.2 61666 123428 85066 37.9% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.16 22.16 0.00 0.00 0.0000 0.0000 1884822.64 1884822.64 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.76 62.11% 61666.41 52774 81244 61659.22 52774 73233 848702 848702 0.00
crit 8.39 37.89% 123427.62 105549 162488 123375.59 0 162488 1036120 1036120 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Metamorphosis (_impact) 1758 0.3% 2.0 0.00sec 347741 0 Direct 6.9 72582 145150 100256 38.1% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 6.92 0.00 0.00 0.0000 0.0000 694055.28 694055.28 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.28 61.86% 72581.61 67669 81203 72241.16 0 81203 310855 310855 0.00
crit 2.64 38.14% 145150.23 135338 162406 139410.36 0 162406 383200 383200 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 14076 2.5% 24.7 11.76sec 224758 0 Direct 24.7 162923 326090 224759 37.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.72 24.72 0.00 0.00 0.0000 0.0000 5556720.41 8168905.36 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 15.35 62.10% 162922.78 123216 189685 162936.18 141472 182341 2501457 3677379 31.98
crit 9.37 37.90% 326089.86 246432 379371 326071.71 272678 379371 3055263 4491526 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 42931 (95781) 7.8% (17.4%) 47.9 8.43sec 795075 618921 Direct 107.3 115230 230406 158864 37.9% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.87 107.32 0.00 0.00 1.2846 0.0000 17048873.81 25063459.41 31.98 618921.31 618921.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 66.66 62.11% 115229.56 97105 149490 115217.05 109605 120408 7680836 11291557 31.98
crit 40.66 37.89% 230406.19 194211 298979 230382.41 215521 245752 9368038 13771903 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 52850 9.6% 0.0 0.00sec 0 0 Periodic 351.5 59780 0 59780 0.0% 0.0% 175.6%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 351.53 351.53 0.0000 2.0000 21014786.53 21014786.53 0.00 29890.42 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 351.5 100.00% 59779.90 29132 157224 59796.26 51011 69977 21014787 21014787 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 5146 0.9% 25.4 15.91sec 80324 0 Direct 83.4 17725 35464 24464 38.0% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.40 83.40 0.00 0.00 0.0000 0.0000 2040297.54 2999430.65 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 51.72 62.02% 17725.41 17233 22107 17722.56 17233 18633 916804 1347789 31.98
crit 31.68 37.98% 35463.79 34465 44215 35456.63 34465 37779 1123493 1651641 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Mortwraith
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Blur 0.2 184.14sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.20 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Chaos Blades 3.7 122.39sec

Stats details: chaos_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.73 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: chaos_blades

Static Values
  • id:211048
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
Spelldata
  • id:211048
  • name:Chaos Blades
  • school:physical
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
 
Consume Magic 12.6 32.66sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.60 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mortwraith
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 0.00sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.2665 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 18.0 0.0 15.8sec 15.8sec 4.56% 4.56% 0.0(0.0) 18.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 7.17% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 0.2 0.0 177.9sec 177.9sec 0.50% 0.50% 0.0(0.0) 0.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:0.50%

Trigger Attempt Success

  • trigger_pct:18.75%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Chaos Blades 3.7 0.0 121.7sec 122.4sec 11.07% 14.14% 0.0(0.0) 3.6

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_chaos_blades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • chaos_blades_1:11.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:211048
  • name:Chaos Blades
  • tooltip:Damage done increased by $w2%. Auto attack damage increased by {$s1=200}%, and deal Chaos damage.
  • description:Increases all damage done by {$185164s1=0}% (based on Mastery) for {$d=12 seconds}. While active, your auto attack deals {$s1=200}% increased damage, and causes Chaos damage.
  • max_stacks:0
  • duration:12.00
  • cooldown:120.00
  • default_chance:0.00%
Death Sweep 5.4 0.0 56.0sec 56.0sec 1.36% 1.36% 0.0(0.0) 5.4

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 2.1 0.0 112.5sec 112.5sec 0.13% 0.13% 0.0(0.0) 2.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.13%

Trigger Attempt Success

  • trigger_pct:95.60%
Metamorphosis 12.3 0.5 33.6sec 30.8sec 20.35% 19.44% 0.5(0.5) 12.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:20.35%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 58.7 1.6 6.9sec 6.7sec 59.13% 64.30% 1.6(1.6) 58.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:59.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 26.6 26.6 15.1sec 7.4sec 2.34% 2.34% 26.6(26.6) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:2.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 245.9sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Prepared 25.4 0.0 15.9sec 15.9sec 31.52% 31.52% 252.3(252.3) 25.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_prepared
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:4.00

Stack Uptimes

  • prepared_1:31.52%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203650
  • name:Prepared
  • tooltip:Generating ${$m1*2} Fury every sec.
  • description:{$@spelldesc203551=Reduces the cooldown of Vengeful Retreat by 10 sec, and generates $203650o1 Fury over {$203650d=5 seconds} if you damage at least one enemy with Vengeful Retreat.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Rage of the Illidari 7.1 441.5 60.6sec 0.8sec 5.29% 5.29% 441.5(441.5) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rage_of_the_illidari
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rage_of_the_illidari_1:5.29%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217060
  • name:Rage of the Illidari
  • tooltip:
  • description:{$@spelldesc201472=When Fury of the Illidari ends, {$s1=60}% of the damage it dealt erupts in an explosion of fel energy, dividing that Chaos damage among all neaby enemies.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.02% 10.02% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Adaptation 4.2 0.0 105.4sec 99.8sec 20.69% 20.69% 0.0(0.0) 4.1

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_rapid_adaptation
  • max_stacks:1
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:2154.27

Stack Uptimes

  • rapid_adaptation_1:20.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:170397
  • name:Rapid Adaptation
  • tooltip:Increases Versatility by {$s1=2036}.
  • description:Increases Versatility by {$s1=2036} for {$d=20 seconds}.
  • max_stacks:0
  • duration:20.00
  • cooldown:0.00
  • default_chance:0.00%
vengeful_retreat_movement 25.4 0.0 15.9sec 15.9sec 6.34% 6.34% 0.0(0.0) 25.3

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:6.34%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mortwraith
annihilation Fury 18.2 727.9 40.0 40.0 11054.3
blade_dance Fury 18.0 630.5 35.0 35.0 29547.2
chaos_strike Fury 81.4 3256.2 40.0 40.0 7429.7
death_sweep Fury 5.4 188.1 35.0 35.0 46734.5
eye_beam Fury 11.8 591.3 50.0 50.0 65715.6
Resource Gains Type Count Total Average Overflow
prepared Fury 252.28 976.04 (17.93%) 3.87 33.10 3.28%
fel_rush_dmg Fury 34.94 869.56 (15.97%) 24.89 3.83 0.44%
consume_magic Fury 12.60 478.93 (8.80%) 38.01 151.02 23.97%
annihilation Fury 6.90 137.98 (2.53%) 20.00 0.00 0.00%
demons_bite Fury 94.67 2365.16 (43.44%) 24.98 1.26 0.05%
chaos_strike Fury 30.84 616.71 (11.33%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.60 13.47
Combat End Resource Mean Min Max
Fury 49.81 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 1.8%

Procs

Count Interval
delayed_swing__out_of_range 4.0 94.1sec
delayed_swing__channeling 15.3 47.4sec
demons_bite_in_meta 19.2 15.4sec

Statistics & Data Analysis

Fight Length
Sample Data Mortwraith Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Mortwraith Damage Per Second
Count 9999
Mean 550813.15
Minimum 451882.16
Maximum 676738.60
Spread ( max - min ) 224856.43
Range [ ( max - min ) / 2 * 100% ] 20.41%
Standard Deviation 41112.0734
5th Percentile 490818.34
95th Percentile 623710.69
( 95th Percentile - 5th Percentile ) 132892.35
Mean Distribution
Standard Deviation 411.1413
95.00% Confidence Intervall ( 550007.33 - 551618.97 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 214
0.1% Error 21400
0.1 Scale Factor Error with Delta=300 14428541
0.05 Scale Factor Error with Delta=300 57714165
0.01 Scale Factor Error with Delta=300 1442854136
Priority Target DPS
Sample Data Mortwraith Priority Target Damage Per Second
Count 9999
Mean 258355.66
Minimum 234215.58
Maximum 288486.85
Spread ( max - min ) 54271.27
Range [ ( max - min ) / 2 * 100% ] 10.50%
Standard Deviation 7066.0403
5th Percentile 247186.15
95th Percentile 270378.66
( 95th Percentile - 5th Percentile ) 23192.51
Mean Distribution
Standard Deviation 70.6639
95.00% Confidence Intervall ( 258217.16 - 258494.16 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 28
0.1% Error 2873
0.1 Scale Factor Error with Delta=300 426222
0.05 Scale Factor Error with Delta=300 1704888
0.01 Scale Factor Error with Delta=300 42622202
DPS(e)
Sample Data Mortwraith Damage Per Second (Effective)
Count 9999
Mean 550813.15
Minimum 451882.16
Maximum 676738.60
Spread ( max - min ) 224856.43
Range [ ( max - min ) / 2 * 100% ] 20.41%
Damage
Sample Data Mortwraith Damage
Count 9999
Mean 218762692.73
Minimum 182015446.44
Maximum 256658990.41
Spread ( max - min ) 74643543.98
Range [ ( max - min ) / 2 * 100% ] 17.06%
DTPS
Sample Data Mortwraith Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mortwraith Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mortwraith Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mortwraith Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mortwraith Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mortwraith Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MortwraithTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mortwraith Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 41.92 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 0.20 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 12.60 consume_magic
B 25.42 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 31.82 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
0.00 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
D 2.86 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
E 7.08 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
F 5.37 death_sweep,if=variable.blade_dance
G 18.12 blade_dance,if=variable.blade_dance
H 22.30 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
I 18.20 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
J 10.18 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
K 11.83 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
L 7.19 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
M 81.40 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
0.00 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
N 94.67 demons_bite
O 5.76 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
P 2.11 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
Q 4.27 use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled|cooldown.chaos_blades.remains>=60
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
R 3.73 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
S 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
T 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

012456RQ9DEAIJBNINIINICINO6INNNINIBDHP6FK6NHNFNC6INHGNBNMHNGNAMCMM6NNMBNHH6GCK6NN6MEGBHNMCMMNNNO6AMMB6GHNCK6NNGL6NMBNNMCMMMNNMO6CH6GABK6NHMRQCNEG6CMHNBNMMMNNMN6CGHK6BHNNGCAMMHC6NMGBNMMNNNMLC6GHNBK6NNGCEHMN6MAMBMNMCMNMLL6N6GCNK6HBNNGNMCH6MMNNABMMMCH6GNK6CHNNSRQTBFENHIAFNIC6ININIBIOP6FHAINIFC6NHINBGNMLK6NCMO6MNBMP6GNHMNMN6AGNLBEMNMCMJMN6NK6BNJMCMMNNAMO6NMBMNMCJMMNNNO6MBM6MMCMNJNNRQK6ECMJNBNMMANMMCJ6MMNNBJMMCMNMN

Sample Sequence Table

time name target resources buffs
Pre flask Mortwraith 0.0/100: 0% fury
Pre food Mortwraith 0.0/100: 0% fury
Pre augmentation Mortwraith 0.0/100: 0% fury
Pre potion Fluffy_Pillow 0.0/100: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 chaos_blades Fluffy_Pillow 0.0/100: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 0.0/100: 0% fury metamorphosis, chaos_blades, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/100: 0% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:00.500 throw_glaive Fluffy_Pillow 25.0/100: 25% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:01.604 fury_of_the_illidari Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:02.455 consume_magic Fluffy_Pillow 25.0/100: 25% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:02.455 annihilation Fluffy_Pillow 75.0/100: 75% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:03.305 throw_glaive Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, momentum, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.155 vengeful_retreat Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
0:04.155 demons_bite Fluffy_Pillow 35.0/100: 35% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.007 annihilation Fluffy_Pillow 63.0/100: 63% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:05.858 demons_bite Fluffy_Pillow 31.0/100: 31% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:06.710 annihilation Fluffy_Pillow 68.0/100: 68% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:07.560 annihilation Fluffy_Pillow 52.0/100: 52% fury bloodlust, metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
0:08.412 demons_bite Fluffy_Pillow 40.0/100: 40% fury bloodlust, metamorphosis, chaos_blades, prepared, potion_of_the_old_war, rapid_adaptation
0:09.263 annihilation Fluffy_Pillow 74.0/100: 74% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:10.115 fel_rush Fluffy_Pillow 34.0/100: 34% fury bloodlust, metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
0:10.488 annihilation Fluffy_Pillow 59.0/100: 59% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:11.340 demons_bite Fluffy_Pillow 19.0/100: 19% fury bloodlust, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
0:12.192 throw_glaive Fluffy_Pillow 46.0/100: 46% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.044 auto_attack Fluffy_Pillow 46.0/100: 46% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.044 annihilation Fluffy_Pillow 46.0/100: 46% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:13.894 demons_bite Fluffy_Pillow 26.0/100: 26% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
0:14.743 demons_bite Fluffy_Pillow 50.0/100: 50% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:15.594 demons_bite Fluffy_Pillow 70.0/100: 70% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:16.444 annihilation Fluffy_Pillow 91.0/100: 91% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:17.293 demons_bite Fluffy_Pillow 51.0/100: 51% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.144 annihilation Fluffy_Pillow 71.0/100: 71% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:18.995 vengeful_retreat Fluffy_Pillow 51.0/100: 51% fury bloodlust, metamorphosis, potion_of_the_old_war, rapid_adaptation
0:19.155 throw_glaive Fluffy_Pillow 51.0/100: 51% fury bloodlust, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
0:20.004 throw_glaive Fluffy_Pillow 55.0/100: 55% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war
0:20.854 fel_rush Fluffy_Pillow 63.0/100: 63% fury bloodlust, raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war
0:21.356 Waiting 0.400 sec 92.0/100: 92% fury bloodlust, metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war
0:21.756 auto_attack Fluffy_Pillow 96.0/100: 96% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:21.756 death_sweep Fluffy_Pillow 96.0/100: 96% fury bloodlust, metamorphosis, momentum, prepared, potion_of_the_old_war
0:22.606 eye_beam Fluffy_Pillow 65.0/100: 65% fury bloodlust, metamorphosis, death_sweep, momentum, prepared, potion_of_the_old_war
0:23.999 auto_attack Fluffy_Pillow 27.0/100: 27% fury bloodlust, metamorphosis, momentum, prepared
0:23.999 demons_bite Fluffy_Pillow 27.0/100: 27% fury bloodlust, metamorphosis, momentum, prepared
0:24.848 throw_glaive Fluffy_Pillow 56.0/100: 56% fury bloodlust, metamorphosis, momentum
0:25.699 demons_bite Fluffy_Pillow 56.0/100: 56% fury bloodlust, metamorphosis
0:26.551 death_sweep Fluffy_Pillow 79.0/100: 79% fury bloodlust, metamorphosis
0:27.400 demons_bite Fluffy_Pillow 44.0/100: 44% fury bloodlust, metamorphosis, death_sweep
0:28.251 fel_rush Fluffy_Pillow 68.0/100: 68% fury bloodlust, raid_movement, metamorphosis
0:28.728 Waiting 0.300 sec 93.0/100: 93% fury bloodlust, raid_movement, metamorphosis, momentum
0:29.028 auto_attack Fluffy_Pillow 93.0/100: 93% fury bloodlust, metamorphosis, momentum
0:29.028 annihilation Fluffy_Pillow 93.0/100: 93% fury bloodlust, metamorphosis, momentum
0:29.879 demons_bite Fluffy_Pillow 53.0/100: 53% fury bloodlust, metamorphosis, momentum
0:30.729 throw_glaive Fluffy_Pillow 74.0/100: 74% fury bloodlust, momentum
0:31.792 blade_dance Fluffy_Pillow 74.0/100: 74% fury bloodlust, momentum
0:32.856 demons_bite Fluffy_Pillow 39.0/100: 39% fury bloodlust
0:33.919 vengeful_retreat Fluffy_Pillow 62.0/100: 62% fury bloodlust
0:34.155 demons_bite Fluffy_Pillow 62.0/100: 62% fury bloodlust, momentum, prepared, vengeful_retreat_movement
0:35.217 Waiting 0.200 sec 97.0/100: 97% fury bloodlust, momentum, out_of_range, prepared
0:35.417 chaos_strike Fluffy_Pillow 97.0/100: 97% fury bloodlust, momentum, prepared
0:36.477 throw_glaive Fluffy_Pillow 65.0/100: 65% fury bloodlust, momentum, prepared
0:37.541 demons_bite Fluffy_Pillow 73.0/100: 73% fury bloodlust, momentum, prepared
0:38.604 blade_dance Fluffy_Pillow 100.0/100: 100% fury bloodlust, prepared
0:39.912 demons_bite Fluffy_Pillow 69.0/100: 69% fury bloodlust
0:40.973 consume_magic Fluffy_Pillow 90.0/100: 90% fury bloodlust
0:40.973 chaos_strike Fluffy_Pillow 100.0/100: 100% fury bloodlust
0:42.036 fel_rush Fluffy_Pillow 60.0/100: 60% fury
0:42.421 chaos_strike Fluffy_Pillow 85.0/100: 85% fury momentum
0:43.804 chaos_strike Fluffy_Pillow 65.0/100: 65% fury momentum
0:45.184 auto_attack Fluffy_Pillow 25.0/100: 25% fury momentum
0:45.184 demons_bite Fluffy_Pillow 25.0/100: 25% fury momentum
0:46.566 demons_bite Fluffy_Pillow 47.0/100: 47% fury
0:47.945 chaos_strike Fluffy_Pillow 76.0/100: 76% fury
0:49.325 vengeful_retreat Fluffy_Pillow 36.0/100: 36% fury
0:49.325 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum, prepared, vengeful_retreat_movement
0:50.704 throw_glaive Fluffy_Pillow 67.0/100: 67% fury raid_movement, momentum, prepared
0:52.084 Waiting 0.700 sec 79.0/100: 79% fury raid_movement, momentum, prepared
0:52.784 throw_glaive Fluffy_Pillow 83.0/100: 83% fury raid_movement, momentum, prepared
0:54.344 auto_attack Fluffy_Pillow 99.0/100: 99% fury
0:54.344 blade_dance Fluffy_Pillow 99.0/100: 99% fury
0:55.725 fel_rush Fluffy_Pillow 64.0/100: 64% fury
0:56.163 eye_beam Fluffy_Pillow 89.0/100: 89% fury momentum
0:58.221 auto_attack Fluffy_Pillow 39.0/100: 39% fury momentum
0:58.221 demons_bite Fluffy_Pillow 39.0/100: 39% fury momentum
0:59.600 demons_bite Fluffy_Pillow 67.0/100: 67% fury momentum
1:00.981 auto_attack Fluffy_Pillow 91.0/100: 91% fury
1:00.981 chaos_strike Fluffy_Pillow 91.0/100: 91% fury
1:02.361 fury_of_the_illidari Fluffy_Pillow 71.0/100: 71% fury
1:03.742 blade_dance Fluffy_Pillow 71.0/100: 71% fury rage_of_the_illidari
1:05.122 vengeful_retreat Fluffy_Pillow 36.0/100: 36% fury rage_of_the_illidari
1:05.122 throw_glaive Fluffy_Pillow 36.0/100: 36% fury momentum, prepared, rage_of_the_illidari, vengeful_retreat_movement
1:06.503 demons_bite Fluffy_Pillow 44.0/100: 44% fury momentum, prepared
1:07.884 chaos_strike Fluffy_Pillow 82.0/100: 82% fury momentum, prepared
1:09.263 fel_rush Fluffy_Pillow 54.0/100: 54% fury prepared
1:09.642 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum, prepared
1:11.022 chaos_strike Fluffy_Pillow 47.0/100: 47% fury momentum
1:12.405 demons_bite Fluffy_Pillow 7.0/100: 7% fury momentum
1:13.785 demons_bite Fluffy_Pillow 29.0/100: 29% fury
1:15.164 demons_bite Fluffy_Pillow 58.0/100: 58% fury
1:16.546 throw_glaive Fluffy_Pillow 81.0/100: 81% fury raid_movement
1:17.927 auto_attack Fluffy_Pillow 81.0/100: 81% fury
1:17.927 consume_magic Fluffy_Pillow 81.0/100: 81% fury
1:17.927 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
1:19.308 chaos_strike Fluffy_Pillow 80.0/100: 80% fury
1:20.689 vengeful_retreat Fluffy_Pillow 40.0/100: 40% fury raid_movement
1:20.689 auto_attack Fluffy_Pillow 40.0/100: 40% fury momentum, prepared, vengeful_retreat_movement
1:20.689 blade_dance Fluffy_Pillow 40.0/100: 40% fury momentum, prepared, vengeful_retreat_movement
1:22.070 throw_glaive Fluffy_Pillow 13.0/100: 13% fury momentum, prepared
1:23.451 demons_bite Fluffy_Pillow 25.0/100: 25% fury momentum, prepared
1:24.833 fel_rush Fluffy_Pillow 62.0/100: 62% fury prepared
1:25.252 eye_beam Fluffy_Pillow 91.0/100: 91% fury momentum, prepared
1:27.335 auto_attack Fluffy_Pillow 45.0/100: 45% fury momentum
1:27.335 demons_bite Fluffy_Pillow 45.0/100: 45% fury momentum
1:28.716 demons_bite Fluffy_Pillow 67.0/100: 67% fury momentum
1:30.094 blade_dance Fluffy_Pillow 94.0/100: 94% fury
1:31.474 throw_glaive Fluffy_Pillow 59.0/100: 59% fury
1:32.855 Waiting 0.100 sec 59.0/100: 59% fury raid_movement
1:32.955 auto_attack Fluffy_Pillow 59.0/100: 59% fury
1:32.955 demons_bite Fluffy_Pillow 59.0/100: 59% fury
1:34.334 chaos_strike Fluffy_Pillow 82.0/100: 82% fury
1:35.715 vengeful_retreat Fluffy_Pillow 42.0/100: 42% fury
1:35.715 demons_bite Fluffy_Pillow 42.0/100: 42% fury momentum, prepared, vengeful_retreat_movement
1:37.096 demons_bite Fluffy_Pillow 74.0/100: 74% fury momentum, prepared
1:38.478 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
1:39.858 fel_rush Fluffy_Pillow 72.0/100: 72% fury prepared
1:40.261 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared
1:41.642 chaos_strike Fluffy_Pillow 84.0/100: 84% fury momentum
1:43.022 chaos_strike Fluffy_Pillow 44.0/100: 44% fury momentum
1:44.404 demons_bite Fluffy_Pillow 24.0/100: 24% fury
1:45.784 demons_bite Fluffy_Pillow 47.0/100: 47% fury
1:47.165 chaos_strike Fluffy_Pillow 74.0/100: 74% fury
1:48.544 throw_glaive Fluffy_Pillow 34.0/100: 34% fury raid_movement
1:49.925 auto_attack Fluffy_Pillow 34.0/100: 34% fury
1:49.925 fel_rush Fluffy_Pillow 34.0/100: 34% fury
1:50.358 throw_glaive Fluffy_Pillow 59.0/100: 59% fury raid_movement, momentum
1:51.740 Waiting 1.200 sec 59.0/100: 59% fury raid_movement, momentum
1:52.940 auto_attack Fluffy_Pillow 59.0/100: 59% fury momentum
1:52.940 blade_dance Fluffy_Pillow 59.0/100: 59% fury momentum
1:54.319 consume_magic Fluffy_Pillow 24.0/100: 24% fury
1:54.319 vengeful_retreat Fluffy_Pillow 74.0/100: 74% fury
1:54.319 eye_beam Fluffy_Pillow 74.0/100: 74% fury momentum, prepared, vengeful_retreat_movement
1:56.428 auto_attack Fluffy_Pillow 40.0/100: 40% fury momentum, prepared
1:56.428 demons_bite Fluffy_Pillow 40.0/100: 40% fury momentum, prepared
1:57.810 throw_glaive Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
1:59.191 chaos_strike Fluffy_Pillow 80.0/100: 80% fury prepared
2:00.572 chaos_blades Fluffy_Pillow 44.0/100: 44% fury
2:00.572 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 44.0/100: 44% fury chaos_blades
2:00.572 fel_rush Fluffy_Pillow 44.0/100: 44% fury chaos_blades, rapid_adaptation
2:00.957 demons_bite Fluffy_Pillow 69.0/100: 69% fury chaos_blades, momentum, rapid_adaptation
2:02.337 fury_of_the_illidari Fluffy_Pillow 97.0/100: 97% fury chaos_blades, momentum, rapid_adaptation
2:03.740 blade_dance Fluffy_Pillow 97.0/100: 97% fury chaos_blades, momentum, rage_of_the_illidari, rapid_adaptation
2:05.121 auto_attack Fluffy_Pillow 62.0/100: 62% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
2:05.121 fel_rush Fluffy_Pillow 62.0/100: 62% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
2:05.533 chaos_strike Fluffy_Pillow 87.0/100: 87% fury chaos_blades, momentum, rapid_adaptation
2:06.913 throw_glaive Fluffy_Pillow 47.0/100: 47% fury chaos_blades, momentum, rapid_adaptation
2:08.293 demons_bite Fluffy_Pillow 47.0/100: 47% fury chaos_blades, momentum, rapid_adaptation
2:09.674 vengeful_retreat Fluffy_Pillow 72.0/100: 72% fury chaos_blades, rapid_adaptation
2:09.674 demons_bite Fluffy_Pillow 72.0/100: 72% fury chaos_blades, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
2:11.053 chaos_strike Fluffy_Pillow 100.0/100: 100% fury chaos_blades, momentum, prepared, rapid_adaptation
2:12.434 chaos_strike Fluffy_Pillow 72.0/100: 72% fury chaos_blades, momentum, prepared, rapid_adaptation
2:13.815 chaos_strike Fluffy_Pillow 64.0/100: 64% fury prepared, rapid_adaptation
2:15.194 demons_bite Fluffy_Pillow 32.0/100: 32% fury rapid_adaptation
2:16.574 demons_bite Fluffy_Pillow 53.0/100: 53% fury rapid_adaptation
2:17.954 chaos_strike Fluffy_Pillow 83.0/100: 83% fury rapid_adaptation
2:19.335 demons_bite Fluffy_Pillow 43.0/100: 43% fury rapid_adaptation
2:20.717 auto_attack Fluffy_Pillow 64.0/100: 64% fury
2:20.717 fel_rush Fluffy_Pillow 64.0/100: 64% fury
2:21.093 blade_dance Fluffy_Pillow 89.0/100: 89% fury momentum
2:22.474 throw_glaive Fluffy_Pillow 54.0/100: 54% fury momentum
2:23.856 eye_beam Fluffy_Pillow 54.0/100: 54% fury momentum
2:25.967 auto_attack Fluffy_Pillow 4.0/100: 4% fury
2:25.967 vengeful_retreat Fluffy_Pillow 4.0/100: 4% fury
2:25.967 throw_glaive Fluffy_Pillow 4.0/100: 4% fury momentum, prepared, vengeful_retreat_movement
2:27.346 demons_bite Fluffy_Pillow 12.0/100: 12% fury momentum, prepared
2:28.726 demons_bite Fluffy_Pillow 52.0/100: 52% fury momentum, prepared
2:30.106 blade_dance Fluffy_Pillow 86.0/100: 86% fury prepared
2:31.646 fel_rush Fluffy_Pillow 59.0/100: 59% fury
2:32.078 consume_magic Fluffy_Pillow 84.0/100: 84% fury momentum
2:32.078 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum
2:33.458 chaos_strike Fluffy_Pillow 80.0/100: 80% fury momentum
2:34.838 throw_glaive Fluffy_Pillow 40.0/100: 40% fury momentum
2:36.219 fel_rush Fluffy_Pillow 40.0/100: 40% fury raid_movement
2:36.576 Waiting 0.400 sec 65.0/100: 65% fury raid_movement, momentum
2:36.976 auto_attack Fluffy_Pillow 65.0/100: 65% fury momentum
2:36.976 demons_bite Fluffy_Pillow 65.0/100: 65% fury momentum
2:38.357 chaos_strike Fluffy_Pillow 92.0/100: 92% fury momentum
2:39.738 blade_dance Fluffy_Pillow 52.0/100: 52% fury momentum
2:41.118 vengeful_retreat Fluffy_Pillow 17.0/100: 17% fury
2:41.118 demons_bite Fluffy_Pillow 17.0/100: 17% fury momentum, prepared, vengeful_retreat_movement
2:42.498 chaos_strike Fluffy_Pillow 48.0/100: 48% fury momentum, prepared
2:43.878 chaos_strike Fluffy_Pillow 40.0/100: 40% fury momentum, prepared
2:45.259 demons_bite Fluffy_Pillow 12.0/100: 12% fury prepared
2:46.639 demons_bite Fluffy_Pillow 41.0/100: 41% fury
2:48.020 demons_bite Fluffy_Pillow 66.0/100: 66% fury
2:49.402 chaos_strike Fluffy_Pillow 93.0/100: 93% fury
2:50.783 throw_glaive Fluffy_Pillow 53.0/100: 53% fury raid_movement
2:52.164 fel_rush Fluffy_Pillow 53.0/100: 53% fury raid_movement
2:52.582 auto_attack Fluffy_Pillow 78.0/100: 78% fury momentum
2:52.582 blade_dance Fluffy_Pillow 78.0/100: 78% fury momentum
2:53.963 throw_glaive Fluffy_Pillow 43.0/100: 43% fury momentum
2:55.343 demons_bite Fluffy_Pillow 43.0/100: 43% fury momentum
2:56.724 vengeful_retreat Fluffy_Pillow 69.0/100: 69% fury
2:56.724 eye_beam Fluffy_Pillow 69.0/100: 69% fury momentum, prepared, vengeful_retreat_movement
2:58.902 auto_attack Fluffy_Pillow 35.0/100: 35% fury momentum, prepared
2:58.902 demons_bite Fluffy_Pillow 35.0/100: 35% fury momentum, prepared
3:00.284 demons_bite Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
3:01.665 blade_dance Fluffy_Pillow 98.0/100: 98% fury prepared
3:03.135 fel_rush Fluffy_Pillow 65.0/100: 65% fury
3:03.551 fury_of_the_illidari Fluffy_Pillow 90.0/100: 90% fury momentum
3:04.931 throw_glaive Fluffy_Pillow 90.0/100: 90% fury momentum, rage_of_the_illidari
3:06.312 chaos_strike Fluffy_Pillow 90.0/100: 90% fury momentum, rage_of_the_illidari
3:07.693 demons_bite Fluffy_Pillow 50.0/100: 50% fury
3:09.074 auto_attack Fluffy_Pillow 78.0/100: 78% fury
3:09.074 chaos_strike Fluffy_Pillow 78.0/100: 78% fury
3:10.454 consume_magic Fluffy_Pillow 58.0/100: 58% fury
3:10.454 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
3:11.835 vengeful_retreat Fluffy_Pillow 60.0/100: 60% fury
3:11.835 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared, vengeful_retreat_movement
3:13.215 demons_bite Fluffy_Pillow 28.0/100: 28% fury momentum, prepared
3:14.596 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared
3:15.976 fel_rush Fluffy_Pillow 32.0/100: 32% fury prepared
3:16.375 chaos_strike Fluffy_Pillow 61.0/100: 61% fury momentum, prepared
3:17.754 demons_bite Fluffy_Pillow 25.0/100: 25% fury momentum
3:19.134 chaos_strike Fluffy_Pillow 53.0/100: 53% fury momentum
3:20.515 throw_glaive Fluffy_Pillow 13.0/100: 13% fury raid_movement
3:21.895 throw_glaive Fluffy_Pillow 13.0/100: 13% fury raid_movement
3:23.276 auto_attack Fluffy_Pillow 13.0/100: 13% fury
3:23.276 demons_bite Fluffy_Pillow 13.0/100: 13% fury
3:24.658 Waiting 0.300 sec 39.0/100: 39% fury raid_movement
3:24.958 auto_attack Fluffy_Pillow 39.0/100: 39% fury
3:24.958 blade_dance Fluffy_Pillow 39.0/100: 39% fury
3:26.338 fel_rush Fluffy_Pillow 4.0/100: 4% fury
3:26.763 demons_bite Fluffy_Pillow 29.0/100: 29% fury momentum
3:28.145 eye_beam Fluffy_Pillow 52.0/100: 52% fury momentum
3:30.274 auto_attack Fluffy_Pillow 2.0/100: 2% fury momentum
3:30.274 throw_glaive Fluffy_Pillow 2.0/100: 2% fury momentum
3:31.655 vengeful_retreat Fluffy_Pillow 2.0/100: 2% fury
3:31.655 demons_bite Fluffy_Pillow 2.0/100: 2% fury momentum, prepared, vengeful_retreat_movement
3:33.035 demons_bite Fluffy_Pillow 36.0/100: 36% fury momentum, prepared
3:34.415 blade_dance Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
3:35.796 demons_bite Fluffy_Pillow 45.0/100: 45% fury prepared
3:37.175 chaos_strike Fluffy_Pillow 78.0/100: 78% fury
3:38.555 fel_rush Fluffy_Pillow 58.0/100: 58% fury
3:39.019 throw_glaive Fluffy_Pillow 83.0/100: 83% fury momentum
3:40.400 Waiting 0.600 sec 83.0/100: 83% fury raid_movement, momentum
3:41.000 auto_attack Fluffy_Pillow 83.0/100: 83% fury momentum
3:41.000 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum
3:42.380 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum
3:43.760 demons_bite Fluffy_Pillow 23.0/100: 23% fury
3:45.140 demons_bite Fluffy_Pillow 46.0/100: 46% fury
3:46.520 consume_magic Fluffy_Pillow 72.0/100: 72% fury
3:46.520 vengeful_retreat Fluffy_Pillow 100.0/100: 100% fury
3:46.655 chaos_strike Fluffy_Pillow 100.0/100: 100% fury momentum, prepared, vengeful_retreat_movement
3:48.036 chaos_strike Fluffy_Pillow 88.0/100: 88% fury momentum, prepared
3:49.418 chaos_strike Fluffy_Pillow 60.0/100: 60% fury momentum, prepared
3:50.799 fel_rush Fluffy_Pillow 32.0/100: 32% fury raid_movement, prepared
3:51.164 throw_glaive Fluffy_Pillow 61.0/100: 61% fury raid_movement, momentum, prepared
3:52.546 Waiting 0.400 sec 65.0/100: 65% fury raid_movement, momentum
3:52.946 auto_attack Fluffy_Pillow 65.0/100: 65% fury momentum
3:52.946 blade_dance Fluffy_Pillow 65.0/100: 65% fury momentum
3:54.327 demons_bite Fluffy_Pillow 30.0/100: 30% fury momentum
3:55.709 eye_beam Fluffy_Pillow 55.0/100: 55% fury
3:57.320 auto_attack Fluffy_Pillow 5.0/100: 5% fury metamorphosis
3:57.320 fel_rush Fluffy_Pillow 5.0/100: 5% fury metamorphosis
3:57.708 throw_glaive Fluffy_Pillow 30.0/100: 30% fury metamorphosis, momentum
3:59.090 demons_bite Fluffy_Pillow 30.0/100: 30% fury momentum
4:00.472 demons_bite Fluffy_Pillow 59.0/100: 59% fury momentum
4:01.854 metamorphosis Fluffy_Pillow 84.0/100: 84% fury
4:03.119 chaos_blades Fluffy_Pillow 84.0/100: 84% fury metamorphosis
4:03.119 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 84.0/100: 84% fury metamorphosis, chaos_blades
4:03.119 potion Fluffy_Pillow 84.0/100: 84% fury metamorphosis, chaos_blades, rapid_adaptation
4:03.119 vengeful_retreat Fluffy_Pillow 84.0/100: 84% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:03.119 death_sweep Fluffy_Pillow 84.0/100: 84% fury metamorphosis, chaos_blades, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:04.223 Waiting 0.200 sec 57.0/100: 57% fury metamorphosis, chaos_blades, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:04.423 fury_of_the_illidari Fluffy_Pillow 57.0/100: 57% fury metamorphosis, chaos_blades, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:05.528 demons_bite Fluffy_Pillow 65.0/100: 65% fury metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:06.633 throw_glaive Fluffy_Pillow 100.0/100: 100% fury metamorphosis, chaos_blades, momentum, prepared, rage_of_the_illidari, potion_of_the_old_war, rapid_adaptation
4:07.738 annihilation Fluffy_Pillow 100.0/100: 100% fury metamorphosis, chaos_blades, prepared, potion_of_the_old_war, rapid_adaptation
4:08.843 consume_magic Fluffy_Pillow 64.0/100: 64% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:08.843 death_sweep Fluffy_Pillow 100.0/100: 100% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:10.096 demons_bite Fluffy_Pillow 65.0/100: 65% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:11.201 annihilation Fluffy_Pillow 93.0/100: 93% fury metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:12.305 fel_rush Fluffy_Pillow 53.0/100: 53% fury raid_movement, metamorphosis, chaos_blades, potion_of_the_old_war, rapid_adaptation
4:12.730 Waiting 0.300 sec 78.0/100: 78% fury raid_movement, metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:13.030 auto_attack Fluffy_Pillow 78.0/100: 78% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:13.030 annihilation Fluffy_Pillow 78.0/100: 78% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:14.136 demons_bite Fluffy_Pillow 38.0/100: 38% fury metamorphosis, chaos_blades, momentum, potion_of_the_old_war, rapid_adaptation
4:15.240 annihilation Fluffy_Pillow 68.0/100: 68% fury metamorphosis, momentum, potion_of_the_old_war, rapid_adaptation
4:16.344 demons_bite Fluffy_Pillow 48.0/100: 48% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:17.449 annihilation Fluffy_Pillow 73.0/100: 73% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.554 vengeful_retreat Fluffy_Pillow 53.0/100: 53% fury metamorphosis, potion_of_the_old_war, rapid_adaptation
4:18.554 annihilation Fluffy_Pillow 53.0/100: 53% fury metamorphosis, momentum, prepared, vengeful_retreat_movement, potion_of_the_old_war, rapid_adaptation
4:19.659 throw_glaive Fluffy_Pillow 21.0/100: 21% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:20.762 fel_rush Fluffy_Pillow 29.0/100: 29% fury raid_movement, metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.152 Waiting 0.500 sec 58.0/100: 58% fury metamorphosis, momentum, out_of_range, prepared, potion_of_the_old_war, rapid_adaptation
4:21.652 auto_attack Fluffy_Pillow 62.0/100: 62% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:21.652 death_sweep Fluffy_Pillow 62.0/100: 62% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:22.757 throw_glaive Fluffy_Pillow 35.0/100: 35% fury metamorphosis, momentum, prepared, potion_of_the_old_war, rapid_adaptation
4:23.996 consume_magic Fluffy_Pillow 43.0/100: 43% fury metamorphosis, momentum, potion_of_the_old_war
4:23.996 annihilation Fluffy_Pillow 93.0/100: 93% fury metamorphosis, momentum, potion_of_the_old_war
4:25.100 demons_bite Fluffy_Pillow 73.0/100: 73% fury metamorphosis, potion_of_the_old_war
4:26.205 annihilation Fluffy_Pillow 100.0/100: 100% fury metamorphosis, potion_of_the_old_war
4:27.310 death_sweep Fluffy_Pillow 60.0/100: 60% fury metamorphosis, potion_of_the_old_war
4:28.628 fel_rush Fluffy_Pillow 25.0/100: 25% fury raid_movement, metamorphosis
4:28.991 auto_attack Fluffy_Pillow 50.0/100: 50% fury metamorphosis, momentum
4:28.991 demons_bite Fluffy_Pillow 50.0/100: 50% fury metamorphosis, momentum
4:30.095 throw_glaive Fluffy_Pillow 80.0/100: 80% fury metamorphosis, momentum
4:31.337 annihilation Fluffy_Pillow 80.0/100: 80% fury metamorphosis, momentum
4:32.441 demons_bite Fluffy_Pillow 60.0/100: 60% fury momentum
4:33.821 vengeful_retreat Fluffy_Pillow 80.0/100: 80% fury
4:33.821 blade_dance Fluffy_Pillow 80.0/100: 80% fury momentum, prepared, vengeful_retreat_movement
4:35.202 demons_bite Fluffy_Pillow 53.0/100: 53% fury momentum, prepared
4:36.584 chaos_strike Fluffy_Pillow 86.0/100: 86% fury momentum, prepared
4:37.964 throw_glaive Fluffy_Pillow 78.0/100: 78% fury prepared
4:39.344 eye_beam Fluffy_Pillow 86.0/100: 86% fury
4:41.457 auto_attack Fluffy_Pillow 36.0/100: 36% fury
4:41.457 demons_bite Fluffy_Pillow 36.0/100: 36% fury
4:42.837 fel_rush Fluffy_Pillow 61.0/100: 61% fury
4:43.201 chaos_strike Fluffy_Pillow 86.0/100: 86% fury momentum
4:44.584 Waiting 0.100 sec 46.0/100: 46% fury raid_movement, momentum
4:44.684 throw_glaive Fluffy_Pillow 46.0/100: 46% fury raid_movement, momentum
4:46.290 auto_attack Fluffy_Pillow 46.0/100: 46% fury momentum
4:46.290 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum
4:47.672 demons_bite Fluffy_Pillow 26.0/100: 26% fury
4:49.053 vengeful_retreat Fluffy_Pillow 46.0/100: 46% fury
4:49.053 chaos_strike Fluffy_Pillow 46.0/100: 46% fury momentum, prepared, vengeful_retreat_movement
4:50.434 fel_rush Fluffy_Pillow 34.0/100: 34% fury raid_movement, momentum, prepared
4:50.802 Waiting 0.500 sec 63.0/100: 63% fury momentum, out_of_range, prepared
4:51.302 auto_attack Fluffy_Pillow 67.0/100: 67% fury momentum, prepared
4:51.302 blade_dance Fluffy_Pillow 67.0/100: 67% fury momentum, prepared
4:52.684 demons_bite Fluffy_Pillow 44.0/100: 44% fury momentum, prepared
4:54.064 throw_glaive Fluffy_Pillow 86.0/100: 86% fury momentum
4:55.463 chaos_strike Fluffy_Pillow 86.0/100: 86% fury
4:56.844 demons_bite Fluffy_Pillow 66.0/100: 66% fury
4:58.225 chaos_strike Fluffy_Pillow 89.0/100: 89% fury
4:59.604 demons_bite Fluffy_Pillow 69.0/100: 69% fury
5:00.984 auto_attack Fluffy_Pillow 96.0/100: 96% fury
5:00.984 consume_magic Fluffy_Pillow 96.0/100: 96% fury
5:00.984 blade_dance Fluffy_Pillow 100.0/100: 100% fury
5:02.364 demons_bite Fluffy_Pillow 65.0/100: 65% fury
5:03.744 throw_glaive Fluffy_Pillow 89.0/100: 89% fury
5:05.125 vengeful_retreat Fluffy_Pillow 89.0/100: 89% fury
5:05.125 fury_of_the_illidari Fluffy_Pillow 89.0/100: 89% fury momentum, prepared, vengeful_retreat_movement
5:06.504 chaos_strike Fluffy_Pillow 97.0/100: 97% fury momentum, prepared, rage_of_the_illidari
5:07.886 demons_bite Fluffy_Pillow 69.0/100: 69% fury momentum, prepared, rage_of_the_illidari
5:09.267 chaos_strike Fluffy_Pillow 100.0/100: 100% fury prepared
5:10.645 fel_rush Fluffy_Pillow 68.0/100: 68% fury
5:11.053 chaos_strike Fluffy_Pillow 93.0/100: 93% fury momentum
5:12.432 throw_glaive Fluffy_Pillow 53.0/100: 53% fury momentum
5:13.812 chaos_strike Fluffy_Pillow 53.0/100: 53% fury momentum
5:15.193 demons_bite Fluffy_Pillow 13.0/100: 13% fury
5:16.574 Waiting 0.400 sec 36.0/100: 36% fury raid_movement
5:16.974 auto_attack Fluffy_Pillow 36.0/100: 36% fury
5:16.974 demons_bite Fluffy_Pillow 36.0/100: 36% fury
5:18.353 eye_beam Fluffy_Pillow 64.0/100: 64% fury
5:20.475 auto_attack Fluffy_Pillow 14.0/100: 14% fury
5:20.475 vengeful_retreat Fluffy_Pillow 14.0/100: 14% fury
5:20.475 demons_bite Fluffy_Pillow 14.0/100: 14% fury momentum, prepared, vengeful_retreat_movement
5:21.853 throw_glaive Fluffy_Pillow 46.0/100: 46% fury momentum, prepared
5:23.236 chaos_strike Fluffy_Pillow 58.0/100: 58% fury momentum, prepared
5:24.616 fel_rush Fluffy_Pillow 30.0/100: 30% fury prepared
5:25.101 chaos_strike Fluffy_Pillow 59.0/100: 59% fury momentum, prepared
5:26.481 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum
5:27.863 demons_bite Fluffy_Pillow 23.0/100: 23% fury momentum
5:29.244 demons_bite Fluffy_Pillow 45.0/100: 45% fury
5:30.624 consume_magic Fluffy_Pillow 69.0/100: 69% fury
5:30.624 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
5:32.004 throw_glaive Fluffy_Pillow 60.0/100: 60% fury raid_movement
5:33.384 auto_attack Fluffy_Pillow 60.0/100: 60% fury
5:33.384 demons_bite Fluffy_Pillow 60.0/100: 60% fury
5:34.764 chaos_strike Fluffy_Pillow 84.0/100: 84% fury
5:36.145 vengeful_retreat Fluffy_Pillow 64.0/100: 64% fury
5:36.145 chaos_strike Fluffy_Pillow 64.0/100: 64% fury momentum, prepared, vengeful_retreat_movement
5:37.526 demons_bite Fluffy_Pillow 32.0/100: 32% fury momentum, prepared
5:38.907 chaos_strike Fluffy_Pillow 74.0/100: 74% fury momentum, prepared
5:40.288 fel_rush Fluffy_Pillow 46.0/100: 46% fury prepared
5:40.638 throw_glaive Fluffy_Pillow 71.0/100: 71% fury momentum, prepared
5:42.017 chaos_strike Fluffy_Pillow 79.0/100: 79% fury momentum
5:43.397 chaos_strike Fluffy_Pillow 59.0/100: 59% fury momentum
5:44.777 demons_bite Fluffy_Pillow 19.0/100: 19% fury
5:46.157 demons_bite Fluffy_Pillow 45.0/100: 45% fury
5:47.538 demons_bite Fluffy_Pillow 70.0/100: 70% fury
5:48.920 throw_glaive Fluffy_Pillow 100.0/100: 100% fury raid_movement
5:50.501 auto_attack Fluffy_Pillow 100.0/100: 100% fury
5:50.501 chaos_strike Fluffy_Pillow 100.0/100: 100% fury
5:51.882 vengeful_retreat Fluffy_Pillow 80.0/100: 80% fury
5:51.882 chaos_strike Fluffy_Pillow 80.0/100: 80% fury momentum, prepared, vengeful_retreat_movement
5:53.262 auto_attack Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
5:53.262 chaos_strike Fluffy_Pillow 68.0/100: 68% fury momentum, prepared
5:54.645 chaos_strike Fluffy_Pillow 40.0/100: 40% fury momentum, prepared
5:56.025 fel_rush Fluffy_Pillow 12.0/100: 12% fury prepared
5:56.457 chaos_strike Fluffy_Pillow 41.0/100: 41% fury momentum, prepared
5:57.837 demons_bite Fluffy_Pillow 5.0/100: 5% fury momentum
5:59.218 throw_glaive Fluffy_Pillow 26.0/100: 26% fury momentum
6:00.600 demons_bite Fluffy_Pillow 26.0/100: 26% fury
6:01.980 demons_bite Fluffy_Pillow 48.0/100: 48% fury
6:03.361 chaos_blades Fluffy_Pillow 69.0/100: 69% fury
6:03.361 use_item_vindictive_gladiators_badge_of_conquest Fluffy_Pillow 69.0/100: 69% fury chaos_blades
6:03.361 eye_beam Fluffy_Pillow 69.0/100: 69% fury chaos_blades, rapid_adaptation
6:05.012 auto_attack Fluffy_Pillow 19.0/100: 19% fury metamorphosis, chaos_blades, rapid_adaptation
6:05.012 fury_of_the_illidari Fluffy_Pillow 19.0/100: 19% fury metamorphosis, chaos_blades, rapid_adaptation
6:06.507 fel_rush Fluffy_Pillow 19.0/100: 19% fury chaos_blades, rage_of_the_illidari, rapid_adaptation
6:06.930 chaos_strike Fluffy_Pillow 44.0/100: 44% fury chaos_blades, momentum, rage_of_the_illidari, rapid_adaptation
6:08.310 throw_glaive Fluffy_Pillow 4.0/100: 4% fury chaos_blades, momentum, rapid_adaptation
6:09.689 demons_bite Fluffy_Pillow 4.0/100: 4% fury chaos_blades, momentum, rapid_adaptation
6:11.070 vengeful_retreat Fluffy_Pillow 32.0/100: 32% fury chaos_blades, rapid_adaptation
6:11.070 demons_bite Fluffy_Pillow 32.0/100: 32% fury chaos_blades, momentum, prepared, vengeful_retreat_movement, rapid_adaptation
6:12.452 chaos_strike Fluffy_Pillow 68.0/100: 68% fury chaos_blades, momentum, prepared, rapid_adaptation
6:13.833 chaos_strike Fluffy_Pillow 40.0/100: 40% fury chaos_blades, momentum, prepared, rapid_adaptation
6:15.212 consume_magic Fluffy_Pillow 12.0/100: 12% fury chaos_blades, prepared, rapid_adaptation
6:15.212 demons_bite Fluffy_Pillow 62.0/100: 62% fury chaos_blades, prepared, rapid_adaptation
6:16.593 chaos_strike Fluffy_Pillow 98.0/100: 98% fury rapid_adaptation
6:17.974 chaos_strike Fluffy_Pillow 78.0/100: 78% fury rapid_adaptation
6:19.355 fel_rush Fluffy_Pillow 58.0/100: 58% fury rapid_adaptation
6:19.776 throw_glaive Fluffy_Pillow 83.0/100: 83% fury momentum, rapid_adaptation
6:21.155 auto_attack Fluffy_Pillow 83.0/100: 83% fury momentum, rapid_adaptation
6:21.155 chaos_strike Fluffy_Pillow 83.0/100: 83% fury momentum, rapid_adaptation
6:22.537 chaos_strike Fluffy_Pillow 43.0/100: 43% fury momentum, rapid_adaptation
6:23.916 demons_bite Fluffy_Pillow 3.0/100: 3% fury
6:25.295 demons_bite Fluffy_Pillow 30.0/100: 30% fury
6:26.675 vengeful_retreat Fluffy_Pillow 50.0/100: 50% fury
6:26.675 throw_glaive Fluffy_Pillow 50.0/100: 50% fury momentum, prepared, vengeful_retreat_movement
6:28.057 chaos_strike Fluffy_Pillow 58.0/100: 58% fury momentum, prepared
6:29.438 chaos_strike Fluffy_Pillow 50.0/100: 50% fury momentum, prepared
6:30.818 fel_rush Fluffy_Pillow 22.0/100: 22% fury prepared
6:31.216 chaos_strike Fluffy_Pillow 51.0/100: 51% fury momentum, prepared
6:32.595 demons_bite Fluffy_Pillow 15.0/100: 15% fury momentum
6:33.975 chaos_strike Fluffy_Pillow 44.0/100: 44% fury momentum
6:35.355 demons_bite Fluffy_Pillow 4.0/100: 4% fury

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 25987 24281 14094 (8121)
Stamina 32604 32604 20855
Intellect 5328 5003 0
Spirit 2 2 0
Health 1956240 1956240 0
Fury 100 100 0
Crit 37.96% 36.89% 7311
Haste 9.01% 9.01% 2927
Damage / Heal Versatility 6.62% 6.62% 2646
Attack Power 25987 24281 0
Mastery 22.12% 22.12% 4943
Armor 2073 2073 2073
Run Speed 9 0 333

Gear

Source Slot Average Item Level: 858.00
Local Head Raddon's Cascading Eyes
ilevel: 895, stats: { 311 Armor, +2959 Sta, +1973 Agi, +882 Crit, +662 Haste }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +200 Agi }, enchant: mark_of_the_hidden_satyr
Local Shoulders Swordsinger's Shoulders
ilevel: 840, stats: { 239 Armor, +886 AgiInt, +1329 Sta, +639 Mastery, +303 Haste }
Local Shirt Ebon Filigreed Doublet
ilevel: 1
Local Chest Dreadhide Chestguard
ilevel: 840, stats: { 318 Armor, +1182 AgiInt, +1773 Sta, +899 Crit, +359 Haste }
Local Waist Dreadhide Girdle
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +606 Crit, +429 Haste }
Local Legs Brinewashed Leather Pants
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +820 Mastery, +484 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 860, stats: { 234 Armor, +1601 Sta, +1068 AgiInt, +704 Mastery, +311 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Reluctant Partisan Gloves
ilevel: 845, stats: { 202 Armor, +929 AgiInt, +1393 Sta, +481 Mastery, +481 Crit }
Local Finger1 Ring of Deep Sea Pearls
ilevel: 870, stats: { +1319 Sta, +1244 Mastery, +735 Vers }, enchant: { +200 Crit }
Local Finger2 Dingy Suramar Mercantile Signet
ilevel: 860, stats: { +1201 Sta, +1362 Crit, +545 Vers }, enchant: { +200 Crit }
Local Trinket1 Nightborne's Hunting Horn
ilevel: 835, stats: { +1073 Agi, +882 Vers }
Local Trinket2 Vindictive Gladiator's Badge of Conquest
ilevel: 840, stats: { +1123 Agi }
Local Back Gossamer-Spun Greatcloak
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +455 Mastery, +322 Crit, +333 RunSpeed }, enchant: { +200 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }, relics: { +42 ilevels, +40 ilevels, +43 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 875, weapon: { 4159 - 7725, 2.6 }, stats: { +702 Agi, +1052 Sta, +312 Crit, +300 Mastery }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Mortwraith"
origin="https://us.api.battle.net/wow/character/thrall/Mortwraith/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/4/157250820-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=alchemy=4/herbalism=82
talents=1133111
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1001:3:1002:3:1003:3:1005:3:1006:3:1010:1:1011:1:1012:1:1013:1:1015:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=use_item,slot=trinket2,if=buff.chaos_blades.up|!talent.chaos_blades.enabled|cooldown.chaos_blades.remains>=60
actions.cooldown+=/nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=raddons_cascading_eyes,id=137061,bonus_id=1811
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=200agi,enchant=mark_of_the_hidden_satyr
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1502/1813
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/42/1487/3337,enchant=200agi
chest=dreadhide_chestguard,id=121297,bonus_id=3473/1502/1674
shirt=ebon_filigreed_doublet,id=42360
tabard=renowned_guild_tabard,id=69210
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=reluctant_partisan_gloves,id=139940,bonus_id=3474/1507/1674
waist=dreadhide_girdle,id=121299,bonus_id=3432/1527/3337
legs=brinewashed_leather_pants,id=134238,bonus_id=3397/1512/3337
feet=manatanned_sandals,id=141430,bonus_id=1472
finger1=ring_of_deep_sea_pearls,id=141545,bonus_id=1482/3336,enchant=200crit
finger2=dingy_suramar_mercantile_signet,id=141492,bonus_id=1472,enchant=200crit
trinket1=nightbornes_hunting_horn,id=134291,bonus_id=3432/607/1497/1674
trinket2=vindictive_gladiators_badge_of_conquest,id=135804,bonus_id=3428/1472
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141255/136719/143687/0,relic_id=3474:1507:1674/1727:1492:1813/3473:1512:3336/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=857.81
# gear_agility=14094
# gear_stamina=20855
# gear_crit_rating=7311
# gear_haste_rating=2927
# gear_mastery_rating=4943
# gear_versatility_rating=2646
# gear_speed_rating=333
# gear_armor=2073

Táunks

Táunks : 521767 dps, 234061 dps to main target

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Havoc
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
521766.9 521766.9 792.8 / 0.152% 147557.1 / 28.3% 39329.1
RPS Out RPS In Primary Resource Waiting APM Active Skill
13.2 13.2 Fury 31.10% 47.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Táunks/advanced
Talents
  • 15: Fel Mastery (Havoc Demon Hunter)
  • 30: Demon Blades (Havoc Demon Hunter)
  • 45: Bloodlet (Havoc Demon Hunter)
  • 60: Soul Rending (Havoc Demon Hunter)
  • 75: Momentum (Havoc Demon Hunter)
  • 90: Master of the Glaive (Havoc Demon Hunter)
  • 100: Fel Barrage (Havoc Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 1
  • skinning: 800
Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 16.92 12.57 11.55 8.61 7.91
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.01 1.01 1.00 1.00 1.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.92, CritRating=11.55, HasteRating=8.61, MasteryRating=7.91, Versatility=12.57 )

Scale Factors for other metrics

Scale Factors for Táunks Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 16.92 12.57 11.55 8.61 7.91
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 1.01 1.01 1.00 1.00 1.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste ~= Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.92, CritRating=11.55, HasteRating=8.61, MasteryRating=7.91, Versatility=12.57 )
Scale Factors for Táunks Priority Target Damage Per Second
Agi Crit Vers Haste Mastery
Scale Factors 7.02 6.17 5.59 4.74 3.55
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.21 0.21 0.21 0.21 0.21
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Vers > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=7.02, CritRating=6.17, HasteRating=4.74, MasteryRating=3.55, Versatility=5.59 )
Scale Factors for Táunks Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 16.92 12.57 11.55 8.61 7.91
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Táunks": Agility=16.92, CritRating=11.55, HasteRating=8.61, MasteryRating=7.91, Versatility=12.57 )
Scale Factors for Táunks Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for Táunks Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )
Scale Factors for TáunksTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Táunks": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Táunks 521767
Annihilation 18437 3.5% 19.3 15.76sec 377925 406545 Direct 38.5 121032 278438 188962 43.2% 0.0%  

Stats details: annihilation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.27 38.55 0.00 0.00 0.9296 0.0000 7284064.11 7284064.11 0.00 406544.85 406544.85
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.91 56.84% 121032.09 97538 146103 121028.26 111167 131574 2651780 2651780 0.00
crit 16.64 43.16% 278438.05 224338 336036 278468.57 0 302621 4632284 4632284 0.00
 
 

Action details: annihilation

Static Values
  • id:201427
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
Spelldata
  • id:201427
  • name:Annihilation
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$227518sw1+$201428sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
auto_attack_mh 8612 1.7% 141.8 2.82sec 24323 12073 Direct 141.8 19585 39166 24322 43.2% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.84 141.84 0.00 0.00 2.0146 0.0000 3450043.02 5071890.03 31.98 12073.47 12073.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.65 37.82% 19585.19 17664 21197 19584.26 18698 20422 1050717 1544653 31.98
crit 61.26 43.19% 39165.61 35328 42394 39163.20 37589 40510 2399326 3527237 31.98
miss 26.93 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4309 0.8% 141.8 2.82sec 12169 6043 Direct 141.8 9793 19582 12169 43.2% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 141.85 141.85 0.00 0.00 2.0139 0.0000 1726192.94 2537667.13 31.98 6042.74 6042.74
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 53.63 37.81% 9792.59 8832 10599 9792.02 9306 10236 525217 772118 31.98
crit 61.33 43.24% 19581.91 17664 21197 19580.87 18731 20314 1200976 1765549 31.98
miss 26.88 18.95% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Dance 50440 9.6% 19.4 14.76sec 1024810 796494 Direct 444.5 31299 62545 44788 43.2% 0.0%  

Stats details: blade_dance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.43 444.53 0.00 0.00 1.2867 0.0000 19909956.60 29269522.13 31.98 796493.84 796493.84
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 252.62 56.83% 31299.34 16443 67815 31302.92 26852 35734 7906792 11623733 31.98
crit 191.91 43.17% 62545.43 32886 135630 62552.77 52987 73609 12003165 17645789 31.98
 
 

Action details: blade_dance

Static Values
  • id:188499
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:188499
  • name:Blade Dance
  • school:physical
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
 
Chaos Strike 59308 11.6% 81.9 4.45sec 292324 224204 Direct 163.7 93631 215369 146255 43.2% 0.0%  

Stats details: chaos_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.92 163.74 0.00 0.00 1.3038 0.0000 23948379.34 23948379.34 0.00 224204.27 224204.27
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.96 56.77% 93631.16 75029 112544 93585.10 88638 97773 8703931 8703931 0.00
crit 70.78 43.23% 215368.65 172568 258851 215285.81 199316 229910 15244448 15244448 0.00
 
 

Action details: chaos_strike

Static Values
  • id:162794
  • school:chaos
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
Spelldata
  • id:162794
  • name:Chaos Strike
  • school:chaos
  • tooltip:
  • description:Slice your target for ${$222031sw1+$199547sw1} Chaos damage. Critical strikes refund {$197125s1=20} Fury.
 
Death Sweep 18361 3.5% 4.9 64.66sec 1490084 1528376 Direct 109.9 46065 92185 65972 43.2% 0.0%  

Stats details: death_sweep

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.86 109.88 0.00 0.00 0.9751 0.0000 7249088.23 10656846.36 31.98 1528376.18 1528376.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 62.45 56.84% 46064.51 24493 101016 46151.07 35578 59679 2876758 4229107 31.98
crit 47.43 43.16% 92185.36 48986 202032 92377.03 65185 122600 4372330 6427740 31.98
 
 

Action details: death_sweep

Static Values
  • id:210152
  • school:physical
  • resource:fury
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.blade_dance
Spelldata
  • id:210152
  • name:Death Sweep
  • school:physical
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
 
Demon Blades 17212 3.3% 169.8 5.87sec 40609 0 Direct 169.8 28359 56720 40608 43.2% 0.0%  

Stats details: demon_blades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.81 169.81 0.00 0.00 0.0000 0.0000 6895856.09 6895856.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.47 56.81% 28359.14 25766 30920 28360.25 27176 29839 2735741 2735741 0.00
crit 73.35 43.19% 56719.75 51533 61840 56722.62 53594 59599 4160115 4160115 0.00
 
 

Action details: demon_blades

Static Values
  • id:203796
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203796
  • name:Demon Blades
  • school:shadow
  • tooltip:
  • description:Inflicts $sw1 Shadow damage and generates $m3 to $M3 Fury.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.85
 
Eye Beam 38047 (53774) 7.3% (10.3%) 7.4 54.10sec 2869776 1551485 Periodic 321.4 0 46912 46912 100.0% 0.0% 2.9%

Stats details: eye_beam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.43 0.00 71.73 321.39 1.8498 0.1628 15077051.12 15077051.12 0.00 1551484.67 1551484.67
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 321.4 100.00% 46911.73 41933 50319 46909.16 42134 50319 15077051 15077051 0.00
 
 

Action details: eye_beam

Static Values
  • id:198013
  • school:chaos
  • resource:fury
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
Spelldata
  • id:198013
  • name:Eye Beam
  • school:chromatic
  • tooltip:
  • description:Blasts all enemies directly in front of you for $<dmg> Chaos damage. Eye Beam always critically strikes.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:2.00
  • base_tick_time:0.20
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Anguish 15727 3.0% 0.0 0.00sec 0 0 Direct 31.5 138018 276026 197620 43.2% 0.0%  

Stats details: anguish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 31.54 0.00 0.00 0.0000 0.0000 6232590.87 6232590.87 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.92 56.82% 138018.02 12921 155056 138013.60 79337 155056 2473129 2473129 0.00
crit 13.62 43.18% 276025.61 25843 310112 276084.58 138443 310112 3759462 3759462 0.00
 
 

Action details: anguish

Static Values
  • id:202446
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202446
  • name:Anguish
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals {$202446s1=10} Chaos damage to the victim per application.}
 
Fel Barrage 43625 8.3% 9.4 44.55sec 1830324 1233760 Direct 146.7 82058 164094 117420 43.1% 0.0%  

Stats details: fel_barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.41 146.69 45.51 0.00 1.4835 0.1983 17224523.54 17224523.54 0.00 1233760.01 1233760.01
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 83.46 56.90% 82057.84 64607 96910 82081.08 0 96910 6848695 6848695 0.00
crit 63.23 43.10% 164094.33 129213 193820 164133.24 0 193820 10375829 10375829 0.00
 
 

Action details: fel_barrage

Static Values
  • id:211053
  • school:chaos
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Spelldata
  • id:211053
  • name:Fel Barrage
  • school:magic
  • tooltip:Unleashing Fel.
  • description:At your command, unleash Fel, inflicting ${{$211052s1=0}} Chaos damage to your target and nearby enemies for each charge. Max 5 charges. Your damaging abilities have a chance to generate a charge.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.00
  • base_tick_time:0.25
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Fel Rush 72569 13.9% 42.5 9.49sec 676043 1673355 Direct 161.5 124342 248687 178072 43.2% 0.0%  

Stats details: fel_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.54 161.52 0.00 0.00 0.4040 0.0000 28761619.98 28761619.98 0.00 1673354.66 1673354.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 91.72 56.79% 124341.98 123463 148156 124344.45 123463 128345 11405262 11405262 0.00
crit 69.79 43.21% 248686.94 246927 296312 248688.67 246927 257189 17356358 17356358 0.00
 
 

Action details: fel_rush

Static Values
  • id:195072
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.2500
  • min_gcd:0.2500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:time=0
Spelldata
  • id:195072
  • name:Fel Rush
  • school:physical
  • tooltip:
  • description:Rush forward, incinerating anything in your path for {$192611s1=0} Chaos damage.$?a192939[ |cFFFFFFFFGenerates {$192939s1=25} Fury if you damage an enemy.|r][]
 
Fury of the Illidari 45128 8.6% 7.1 60.39sec 2523800 2050003 Periodic 448.1 27861 55682 39869 43.2% 0.0% 5.3%

Stats details: fury_of_the_illidari

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.08 0.00 49.39 448.06 1.2312 0.4283 17863730.03 17863730.03 0.00 598069.24 2050003.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 254.7 56.84% 27860.50 16607 39858 27861.49 25416 30861 7095055 7095055 0.00
crit 193.4 43.16% 55681.77 33215 79715 55684.68 50027 61828 10768675 10768675 0.00
 
 

Action details: fury_of_the_illidari

Static Values
  • id:201467
  • school:chaos
  • resource:none
  • range:5.0
  • travel_speed:3.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
Spelldata
  • id:201467
  • name:Fury of the Illidari
  • school:physical
  • tooltip:
  • description:Throws the |cFFFFCC99Twinblades of the Deceiver|r in a whirlwind of energy, causing ${7*($201628sw1+$201789sw1)} Chaos damage over {$d=3 seconds} to all nearby enemies.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Inner Demons 15832 3.0% 7.0 51.78sec 892253 0 Direct 18.5 236649 473412 339171 43.3% 0.0%  

Stats details: inner_demons

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.05 18.54 0.00 0.00 0.0000 0.0000 6286906.11 6286906.11 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.51 56.70% 236648.82 209972 251966 235972.19 0 251966 2487095 2487095 0.00
crit 8.03 43.30% 473411.61 419944 503932 470974.20 0 503932 3799811 3799811 0.00
 
 

Action details: inner_demons

Static Values
  • id:202388
  • school:chaos
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202388
  • name:Inner Demons
  • school:chaos
  • tooltip:
  • description:{$@spelldesc201471=Chaos Strike has a chance to unleash your inner demon, causing it to crash into your target and deal {$202388s1=0} Chaos damage to all nearby enemies.}
 
Metamorphosis (_impact) 1644 0.3% 2.0 243.60sec 324394 0 Direct 6.4 70465 140756 100776 43.1% 0.0%  

Stats details: metamorphosis_impact

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 6.44 0.00 0.00 0.0000 0.0000 649306.67 649306.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.67 56.89% 70464.68 64607 77528 68752.99 0 77528 258283 258283 0.00
crit 2.78 43.11% 140756.36 129213 155056 132858.10 0 155056 391023 391023 0.00
 
 

Action details: metamorphosis_impact

Static Values
  • id:200166
  • school:chaos
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:200166
  • name:Metamorphosis
  • school:chromatic
  • tooltip:Stunned.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
 
Potion of the Old War 11298 2.2% 23.4 12.58sec 190695 0 Direct 23.4 133266 266522 190701 43.1% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.39 23.39 0.00 0.00 0.0000 0.0000 4460716.80 6557676.23 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.31 56.90% 133265.80 118093 141712 133243.22 121045 141712 1773858 2607739 31.98
crit 10.08 43.10% 266522.22 236186 283423 266466.98 236186 283423 2686859 3949937 31.98
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Throw Glaive 43988 (97863) 8.4% (18.8%) 50.3 7.99sec 773210 636325 Direct 114.7 106333 212641 152350 43.3% 0.0%  

Stats details: throw_glaive

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.30 114.66 0.00 0.00 1.2151 0.0000 17468594.91 25680489.19 31.98 636324.76 636324.76
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.03 56.71% 106332.93 93705 112446 106324.20 100398 111145 6914736 10165317 31.98
crit 49.63 43.29% 212640.59 187410 224892 212620.91 200170 224892 10553859 15515172 31.98
 
 

Action details: throw_glaive

Static Values
  • id:185123
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
Spelldata
  • id:185123
  • name:Throw Glaive
  • school:physical
  • tooltip:
  • description:Throw a demonic glaive at the target, dealing $sw1 Physical damage. The glaive can ricochet to ${$x1-1} additional enemies within 10 yards.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.90
 
    Bloodlet 53875 10.3% 0.0 0.00sec 0 0 Periodic 360.4 59445 0 59445 0.0% 0.0% 180.0%

Stats details: bloodlet

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 0.00 360.41 360.41 0.0000 2.0000 21424210.91 21424210.91 0.00 29722.04 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 360.4 100.00% 59444.52 28112 148627 59455.21 50368 68795 21424211 21424211 0.00
 
 

Action details: bloodlet

Static Values
  • id:207690
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:207690
  • name:Bloodlet
  • school:physical
  • tooltip:Inflicts $w1 damage every $t1 sec.
  • description:{$@spelldesc206473=Throw Glaive causes targets to bleed for {$s1=150}% of the damage inflicted over {$207690d=10 seconds}. If this effect is reapplied, any remaining damage will be added to the new Bloodlet.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vengeful Retreat 3354 0.6% 15.9 25.82sec 83848 0 Direct 55.8 16629 33258 23800 43.1% 0.0%  

Stats details: vengeful_retreat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.85 55.85 0.00 0.00 0.0000 0.0000 1329214.18 1954070.75 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.76 56.87% 16629.11 16629 16629 16629.11 16629 16629 528193 776494 31.98
crit 24.08 43.13% 33258.21 33258 33258 33258.21 33258 33258 801021 1177577 31.98
 
 

Action details: vengeful_retreat

Static Values
  • id:198793
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:25.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Spelldata
  • id:198793
  • name:Vengeful Retreat
  • school:physical
  • tooltip:
  • description:Remove all snares and vault away. Nearby enemies take $198813sw2 Physical damage and have their movement speed reduced by {$198813s1=70}% for {$198813d=3 seconds}.$?a203551[ |cFFFFFFFFGenerates $203650o1 Fury over {$203650d=5 seconds} if you damage an enemy.|r][]
 
Simple Action Stats Execute Interval
Táunks
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Blur 3.5 106.30sec

Stats details: blur

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.48 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blur

Static Values
  • id:198589
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
Spelldata
  • id:198589
  • name:Blur
  • school:physical
  • tooltip:
  • description:Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.
 
Consume Magic 13.3 30.81sec

Stats details: consume_magic

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.27 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_magic

Static Values
  • id:183752
  • school:chromatic
  • resource:none
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:183752
  • name:Consume Magic
  • school:chromatic
  • tooltip:
  • description:Interrupts the enemy's spellcasting and locks them from that school of magic for {$d=3 seconds}.|cFFFFFFFF{$?s178940=false}[ Generates {$218903s1=50} Fury on a successful interrupt.][ Generates ${{$218903s2=500}/10} Pain on a successful interrupt.]|r
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Táunks
  • harmful:false
  • if_expr:
 
Metamorphosis 1.0 243.60sec

Stats details: metamorphosis

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 1.1432 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: metamorphosis

Static Values
  • id:191427
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:1.0000
  • trigger_gcd:1.5000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:240.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191427
  • name:Metamorphosis
  • school:physical
  • tooltip:
  • description:Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blade Dance 19.4 0.0 14.7sec 14.7sec 4.92% 4.92% 0.0(0.0) 19.4

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blade_dance
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • blade_dance_1:4.92%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188499
  • name:Blade Dance
  • tooltip:Dodge chance increased by {$s2=100}%.
  • description:Strike all nearby enemies for ${$sw2+2*$199552sw2+$200685sw2} Physical damage, and increase your chance to dodge by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:10.00
  • default_chance:0.00%
Blood Frenzy 14.3 8.6 28.3sec 17.3sec 45.56% 45.56% 8.6(8.6) 13.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 12.61% 0.0(0.0) 1.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Blur 3.5 0.0 106.1sec 106.1sec 8.48% 8.48% 0.0(0.0) 3.4

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_blur
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.35

Stack Uptimes

  • blur_1:8.48%

Trigger Attempt Success

  • trigger_pct:99.99%

Spelldata details

  • id:212800
  • name:Blur
  • tooltip:Dodge increased by {$s2=50}%. All damage reduced by {$s3=35}%.
  • description:{$@spelldesc198589=Increases your chance to dodge by {$212800s2=50}% and reduces all damage taken by {$212800s3=35}% for {$212800d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:60.00
  • default_chance:0.00%
Death Sweep 4.9 0.0 64.7sec 64.7sec 1.23% 1.23% 0.0(0.0) 4.9

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_death_sweep
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

  • death_sweep_1:1.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210152
  • name:Death Sweep
  • tooltip:Dodge chance increased by {$s3=0}%.
  • description:Strike all nearby enemies for ${3*$210153sw2+$210155sw2} Physical damage, and increase your Dodge chance by {$s2=100}% for {$d=1 second}.
  • max_stacks:0
  • duration:1.00
  • cooldown:8.00
  • default_chance:0.00%
fel_rush_movement 1.7 0.0 118.9sec 118.9sec 0.11% 0.11% 0.0(0.0) 1.7

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_fel_rush_movement
  • max_stacks:1
  • duration:0.25
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • fel_rush_movement_1:0.11%

Trigger Attempt Success

  • trigger_pct:92.19%
Metamorphosis 8.0 0.3 53.6sec 49.3sec 18.23% 19.51% 0.3(0.3) 8.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_metamorphosis
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • metamorphosis_1:18.23%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:162264
  • name:Metamorphosis
  • tooltip:Chaos Strike and Blade Dance upgraded to $@spellname201427 and $@spellname210152. Haste increased by {$s7=25}%.
  • description:{$@spelldesc191427=Leap into the air and land with explosive force, dealing {$200166s2=0} Chaos damage to enemies within 8 yds, and stunning them for {$200166d=3 seconds}. Upon landing, you are transformed into a hellish demon for {$162264d=30 seconds}, greatly empowering your Chaos Strike and Blade Dance abilities, and gaining {$162264s7=25}% Haste.}
  • max_stacks:0
  • duration:30.00
  • cooldown:0.00
  • default_chance:0.00%
Momentum 57.4 1.0 7.0sec 7.0sec 57.53% 62.55% 1.0(1.0) 56.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_momentum
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • momentum_1:57.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:208628
  • name:Momentum
  • tooltip:Damage done increased by {$s1=20}%.
  • description:Increases all damage done by {$s1=20}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
out_of_range 16.6 16.6 24.6sec 11.9sec 1.47% 1.47% 16.6(16.6) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_out_of_range
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • out_of_range_1:1.47%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of the Old War 2.0 0.0 248.1sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 10.54% 10.54% 2.0(2.0) 0.0

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:10.54%

Trigger Attempt Success

  • trigger_pct:100.00%
vengeful_retreat_movement 15.9 0.0 25.8sec 25.8sec 3.95% 3.95% 0.0(0.0) 15.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_vengeful_retreat_movement
  • max_stacks:1
  • duration:1.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vengeful_retreat_movement_1:3.95%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Táunks
annihilation Fury 19.3 770.9 40.0 40.0 9448.3
blade_dance Fury 19.4 680.0 35.0 35.0 29280.3
chaos_strike Fury 81.9 3276.9 40.0 40.0 7308.2
death_sweep Fury 4.9 170.3 35.0 35.0 42570.7
eye_beam Fury 7.4 371.3 50.0 50.0 57396.8
Resource Gains Type Count Total Average Overflow
demon_blades Fury 169.81 2710.46 (51.12%) 15.96 6.53 0.24%
fel_rush_dmg Fury 42.54 1063.45 (20.06%) 25.00 0.16 0.01%
consume_magic Fury 13.27 654.09 (12.34%) 49.29 9.37 1.41%
annihilation Fury 8.32 166.34 (3.14%) 20.00 0.00 0.00%
chaos_strike Fury 35.37 707.32 (13.34%) 20.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Fury 13.24 13.16
Combat End Resource Mean Min Max
Fury 32.30 0.00 130.00

Benefits & Uptimes

Benefits %
Uptimes %
Fury Cap 0.1%

Procs

Count Interval
delayed_swing__out_of_range 3.9 109.8sec
delayed_swing__channeling 14.1 57.7sec
demon_blades_wasted 0.4 15.7sec
fel_barrage 26.2 14.9sec

Statistics & Data Analysis

Fight Length
Sample Data Táunks Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Táunks Damage Per Second
Count 9999
Mean 521766.92
Minimum 415372.67
Maximum 663002.20
Spread ( max - min ) 247629.52
Range [ ( max - min ) / 2 * 100% ] 23.73%
Standard Deviation 40448.8795
5th Percentile 462820.02
95th Percentile 593359.98
( 95th Percentile - 5th Percentile ) 130539.97
Mean Distribution
Standard Deviation 404.5090
95.00% Confidence Intervall ( 520974.10 - 522559.74 )
Normalized 95.00% Confidence Intervall ( 99.85% - 100.15% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 230
0.1% Error 23086
0.1 Scale Factor Error with Delta=300 13966791
0.05 Scale Factor Error with Delta=300 55867167
0.01 Scale Factor Error with Delta=300 1396679179
Priority Target DPS
Sample Data Táunks Priority Target Damage Per Second
Count 9999
Mean 234060.69
Minimum 202852.80
Maximum 270019.75
Spread ( max - min ) 67166.95
Range [ ( max - min ) / 2 * 100% ] 14.35%
Standard Deviation 8540.8129
5th Percentile 220262.92
95th Percentile 248363.01
( 95th Percentile - 5th Percentile ) 28100.08
Mean Distribution
Standard Deviation 85.4124
95.00% Confidence Intervall ( 233893.29 - 234228.10 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 51
0.1% Error 5114
0.1 Scale Factor Error with Delta=300 622704
0.05 Scale Factor Error with Delta=300 2490818
0.01 Scale Factor Error with Delta=300 62270461
DPS(e)
Sample Data Táunks Damage Per Second (Effective)
Count 9999
Mean 521766.92
Minimum 415372.67
Maximum 663002.20
Spread ( max - min ) 247629.52
Range [ ( max - min ) / 2 * 100% ] 23.73%
Damage
Sample Data Táunks Damage
Count 9999
Mean 207242045.43
Minimum 169024175.97
Maximum 248734461.59
Spread ( max - min ) 79710285.62
Range [ ( max - min ) / 2 * 100% ] 19.23%
DTPS
Sample Data Táunks Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Táunks Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Táunks Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Táunks Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Táunks Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Táunks Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data TáunksTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Táunks Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 metamorphosis
Default action list Executed every time the actor is available.
# count action,conditions
6 42.05 auto_attack
0.00 variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
"Getting ready to use meta" conditions, this is used in a few places.
0.00 variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
0.00 variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on # single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
7 3.48 blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
8 0.00 call_action_list,name=cooldown
9 1.00 fel_rush,animation_cancel=1,if=time=0
Fel Rush in at the start of combat.
0.00 pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
A 13.27 consume_magic
B 15.97 vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
Vengeful Retreat backwards through the target to minimize downtime.
C 39.88 fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
Fel Rush for Momentum and for fury from Fel Mastery.
D 3.45 fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
E 2.36 throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
F 7.10 fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
0.00 eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
G 4.89 death_sweep,if=variable.blade_dance
H 19.50 blade_dance,if=variable.blade_dance
I 20.43 throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
0.00 fel_eruption
0.00 felblade,if=fury.deficit>=30+buff.prepared.up*8
J 19.27 annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
K 11.01 throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
L 7.43 eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
0.00 demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
M 9.50 throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
N 81.92 chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
O 5.96 fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
0.00 fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
0.00 demons_bite
P 7.15 throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
0.00 felblade,if=movement.distance|buff.out_of_range.up
Q 1.66 fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
0.00 vengeful_retreat,if=movement.distance>15
actions.cooldown
# count action,conditions
0.00 nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
0.00 nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
0.00 nemesis,sync=metamorphosis,if=!raid_event.adds.exists
0.00 chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
R 1.00 metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
S 1.00 potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

Sample Sequence

0124569D6EAFJBKJJKJCJJP6JJJJPC6IGL6P6BHCINHANNCP6NNNM6HBICN6NFCHINL6NP6ANCNQ6HIBNNHC7O6ICNHNNNCNP6Q6HIABL6NMHFN6CNNINNNCNOI6BHCINHANMC6NHNNNBONNCII6HC7LCNIHFNM6ANBNNNCNNNM6C6HIACNNHMB6NNCANNNMM6HC6LO6MBFHCARSIJJ6JJJCJJI6GAJJBDI6GICJGJMNCNP6NNANB6HICL6D6HMFCNNNNP6BKCNNNANCK6NNCNKOBLNKN6CC7NNKCNNP6FBNNACNKNNNC6NKNCNLNNBDK

Sample Sequence Table

time name target resources buffs
Pre flask Táunks 0.0/130: 0% fury
Pre food Táunks 0.0/130: 0% fury
Pre augmentation Táunks 0.0/130: 0% fury
Pre potion Fluffy_Pillow 0.0/130: 0% fury potion_of_the_old_war
0:00.000 metamorphosis Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.000 fel_rush Fluffy_Pillow 0.0/130: 0% fury metamorphosis, potion_of_the_old_war
0:00.384 fel_barrage Fluffy_Pillow 25.0/130: 19% fury metamorphosis, momentum, potion_of_the_old_war
0:01.593 auto_attack Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:01.593 throw_glaive Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:02.429 consume_magic Fluffy_Pillow 25.0/130: 19% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:02.429 fury_of_the_illidari Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:03.264 annihilation Fluffy_Pillow 75.0/130: 58% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:04.100 vengeful_retreat Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, potion_of_the_old_war
0:04.100 throw_glaive Fluffy_Pillow 35.0/130: 27% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:04.935 Waiting 0.400 sec 35.0/130: 27% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement, potion_of_the_old_war
0:05.335 annihilation Fluffy_Pillow 89.0/130: 68% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:06.170 annihilation Fluffy_Pillow 49.0/130: 38% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:07.004 throw_glaive Fluffy_Pillow 29.0/130: 22% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:07.976 Waiting 1.400 sec 29.0/130: 22% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:09.376 annihilation Fluffy_Pillow 61.0/130: 47% fury bloodlust, metamorphosis, potion_of_the_old_war
0:10.212 fel_rush Fluffy_Pillow 41.0/130: 32% fury bloodlust, metamorphosis, potion_of_the_old_war
0:10.600 annihilation Fluffy_Pillow 66.0/130: 51% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:11.434 annihilation Fluffy_Pillow 46.0/130: 35% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:12.270 Waiting 0.200 sec 6.0/130: 5% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:12.470 throw_glaive Fluffy_Pillow 6.0/130: 5% fury bloodlust, raid_movement, metamorphosis, momentum, potion_of_the_old_war
0:13.521 auto_attack Fluffy_Pillow 6.0/130: 5% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:13.521 Waiting 1.500 sec 6.0/130: 5% fury bloodlust, metamorphosis, momentum, potion_of_the_old_war
0:15.021 annihilation Fluffy_Pillow 65.0/130: 50% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:15.798 annihilation Fluffy_Pillow 45.0/130: 35% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:16.575 Waiting 1.100 sec 25.0/130: 19% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:17.675 annihilation Fluffy_Pillow 88.0/130: 68% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:18.452 annihilation Fluffy_Pillow 48.0/130: 37% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:19.229 Waiting 0.800 sec 8.0/130: 6% fury bloodlust, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.029 throw_glaive Fluffy_Pillow 8.0/130: 6% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:20.806 fel_rush Fluffy_Pillow 8.0/130: 6% fury bloodlust, raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
0:21.173 Waiting 1.800 sec 33.0/130: 25% fury bloodlust, raid_movement, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:22.973 auto_attack Fluffy_Pillow 33.0/130: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:22.973 throw_glaive Fluffy_Pillow 33.0/130: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
0:23.930 Waiting 0.400 sec 33.0/130: 25% fury bloodlust, metamorphosis, momentum, blood_frenzy
0:24.330 death_sweep Fluffy_Pillow 91.0/130: 70% fury bloodlust, metamorphosis, momentum, blood_frenzy
0:25.108 eye_beam Fluffy_Pillow 56.0/130: 43% fury bloodlust, metamorphosis, death_sweep
0:26.451 auto_attack Fluffy_Pillow 6.0/130: 5% fury bloodlust, metamorphosis
0:26.451 Waiting 1.900 sec 6.0/130: 5% fury bloodlust, metamorphosis
0:28.351 throw_glaive Fluffy_Pillow 6.0/130: 5% fury bloodlust, raid_movement, metamorphosis
0:29.396 auto_attack Fluffy_Pillow 6.0/130: 5% fury bloodlust, metamorphosis
0:29.396 vengeful_retreat Fluffy_Pillow 6.0/130: 5% fury bloodlust, metamorphosis
0:29.396 Waiting 3.200 sec 6.0/130: 5% fury bloodlust, metamorphosis, momentum, vengeful_retreat_movement
0:32.596 blade_dance Fluffy_Pillow 39.0/130: 30% fury bloodlust, momentum, blood_frenzy
0:33.565 fel_rush Fluffy_Pillow 4.0/130: 3% fury bloodlust, blade_dance, blood_frenzy
0:33.905 Waiting 0.500 sec 29.0/130: 22% fury bloodlust, momentum, blood_frenzy
0:34.405 throw_glaive Fluffy_Pillow 46.0/130: 35% fury bloodlust, momentum, blood_frenzy
0:35.605 Waiting 2.000 sec 46.0/130: 35% fury bloodlust, momentum, blood_frenzy
0:37.605 chaos_strike Fluffy_Pillow 95.0/130: 73% fury bloodlust, blood_frenzy
0:38.576 Waiting 0.300 sec 55.0/130: 42% fury bloodlust, blood_frenzy
0:38.876 blade_dance Fluffy_Pillow 55.0/130: 42% fury bloodlust, blood_frenzy
0:40.009 Waiting 0.100 sec 20.0/130: 15% fury bloodlust, blade_dance, blood_frenzy
0:40.109 consume_magic Fluffy_Pillow 20.0/130: 15% fury bloodlust, blood_frenzy
0:40.109 chaos_strike Fluffy_Pillow 70.0/130: 54% fury bloodlust, blood_frenzy
0:41.081 Waiting 2.000 sec 30.0/130: 23% fury blood_frenzy
0:43.081 chaos_strike Fluffy_Pillow 90.0/130: 69% fury blood_frenzy
0:44.340 fel_rush Fluffy_Pillow 70.0/130: 54% fury raid_movement, blood_frenzy
0:44.702 throw_glaive Fluffy_Pillow 95.0/130: 73% fury raid_movement, momentum, blood_frenzy
0:45.963 auto_attack Fluffy_Pillow 95.0/130: 73% fury momentum, blood_frenzy
0:45.963 chaos_strike Fluffy_Pillow 95.0/130: 73% fury momentum, blood_frenzy
0:47.224 chaos_strike Fluffy_Pillow 75.0/130: 58% fury momentum, blood_frenzy
0:48.486 chaos_strike Fluffy_Pillow 55.0/130: 42% fury blood_frenzy
0:49.747 Waiting 0.300 sec 35.0/130: 27% fury blood_frenzy
0:50.047 throw_glaive Fluffy_Pillow 35.0/130: 27% fury raid_movement
0:51.403 Waiting 1.600 sec 35.0/130: 27% fury raid_movement
0:53.003 auto_attack Fluffy_Pillow 35.0/130: 27% fury
0:53.003 blade_dance Fluffy_Pillow 35.0/130: 27% fury
0:54.361 vengeful_retreat Fluffy_Pillow 0.0/130: 0% fury
0:54.396 Waiting 3.000 sec 0.0/130: 0% fury momentum, vengeful_retreat_movement, blood_frenzy
0:57.396 throw_glaive Fluffy_Pillow 69.0/130: 53% fury momentum, blood_frenzy
0:58.862 fel_rush Fluffy_Pillow 101.0/130: 78% fury blood_frenzy
0:59.250 chaos_strike Fluffy_Pillow 126.0/130: 97% fury momentum, blood_frenzy
1:00.511 Waiting 0.500 sec 86.0/130: 66% fury raid_movement, momentum, blood_frenzy
1:01.011 auto_attack Fluffy_Pillow 86.0/130: 66% fury momentum, blood_frenzy
1:01.011 chaos_strike Fluffy_Pillow 86.0/130: 66% fury momentum, blood_frenzy
1:02.271 fury_of_the_illidari Fluffy_Pillow 46.0/130: 35% fury momentum, blood_frenzy
1:03.691 fel_rush Fluffy_Pillow 46.0/130: 35% fury blood_frenzy
1:04.157 blade_dance Fluffy_Pillow 71.0/130: 55% fury momentum, blood_frenzy
1:05.417 Waiting 0.500 sec 36.0/130: 28% fury momentum
1:05.917 throw_glaive Fluffy_Pillow 67.0/130: 52% fury momentum
1:07.454 Waiting 0.400 sec 67.0/130: 52% fury momentum
1:07.854 chaos_strike Fluffy_Pillow 95.0/130: 73% fury
1:09.209 Waiting 0.700 sec 55.0/130: 42% fury
1:09.909 eye_beam Fluffy_Pillow 55.0/130: 42% fury
1:12.160 auto_attack Fluffy_Pillow 5.0/130: 4% fury
1:12.160 Waiting 2.900 sec 5.0/130: 4% fury
1:15.060 chaos_strike Fluffy_Pillow 69.0/130: 53% fury
1:16.415 throw_glaive Fluffy_Pillow 29.0/130: 22% fury raid_movement
1:17.768 auto_attack Fluffy_Pillow 29.0/130: 22% fury
1:17.768 consume_magic Fluffy_Pillow 29.0/130: 22% fury
1:17.768 chaos_strike Fluffy_Pillow 79.0/130: 61% fury
1:19.121 fel_rush Fluffy_Pillow 39.0/130: 30% fury
1:19.467 chaos_strike Fluffy_Pillow 64.0/130: 49% fury momentum
1:20.822 fel_rush Fluffy_Pillow 44.0/130: 34% fury raid_movement, momentum
1:21.267 Waiting 0.400 sec 69.0/130: 53% fury momentum, out_of_range
1:21.667 auto_attack Fluffy_Pillow 69.0/130: 53% fury momentum
1:21.667 blade_dance Fluffy_Pillow 69.0/130: 53% fury momentum
1:23.023 Waiting 0.900 sec 34.0/130: 26% fury momentum
1:23.923 throw_glaive Fluffy_Pillow 34.0/130: 26% fury momentum
1:25.477 vengeful_retreat Fluffy_Pillow 48.0/130: 37% fury
1:25.477 Waiting 1.300 sec 48.0/130: 37% fury momentum, vengeful_retreat_movement
1:26.777 chaos_strike Fluffy_Pillow 84.0/130: 65% fury momentum
1:28.132 Waiting 0.600 sec 64.0/130: 49% fury momentum
1:28.732 chaos_strike Fluffy_Pillow 94.0/130: 72% fury momentum, blood_frenzy
1:29.993 Waiting 0.300 sec 54.0/130: 42% fury blood_frenzy
1:30.293 blade_dance Fluffy_Pillow 54.0/130: 42% fury blood_frenzy
1:31.797 Waiting 0.300 sec 19.0/130: 15% fury blood_frenzy
1:32.097 fel_rush Fluffy_Pillow 19.0/130: 15% fury raid_movement, blood_frenzy
1:32.510 blur Fluffy_Pillow 44.0/130: 34% fury raid_movement, momentum, blood_frenzy
1:32.510 fel_barrage Fluffy_Pillow 44.0/130: 34% fury raid_movement, blur, momentum, blood_frenzy
1:34.003 auto_attack Fluffy_Pillow 44.0/130: 34% fury blur, momentum, blood_frenzy
1:34.003 throw_glaive Fluffy_Pillow 44.0/130: 34% fury blur, momentum, blood_frenzy
1:35.264 Waiting 0.900 sec 44.0/130: 34% fury blur, momentum, blood_frenzy
1:36.164 fel_rush Fluffy_Pillow 44.0/130: 34% fury blur, blood_frenzy
1:36.607 Waiting 1.800 sec 69.0/130: 53% fury blur, momentum, blood_frenzy
1:38.407 chaos_strike Fluffy_Pillow 130.0/130: 100% fury blur, momentum, blood_frenzy
1:39.667 blade_dance Fluffy_Pillow 110.0/130: 85% fury blur, momentum
1:41.022 chaos_strike Fluffy_Pillow 75.0/130: 58% fury blur
1:42.378 chaos_strike Fluffy_Pillow 55.0/130: 42% fury blur
1:43.733 Waiting 1.700 sec 35.0/130: 27% fury
1:45.433 chaos_strike Fluffy_Pillow 63.0/130: 48% fury
1:46.790 fel_rush Fluffy_Pillow 43.0/130: 33% fury
1:47.150 chaos_strike Fluffy_Pillow 68.0/130: 52% fury momentum
1:48.507 throw_glaive Fluffy_Pillow 28.0/130: 22% fury raid_movement, momentum
1:49.862 auto_attack Fluffy_Pillow 28.0/130: 22% fury momentum
1:49.862 Waiting 0.200 sec 28.0/130: 22% fury momentum
1:50.062 fel_rush Fluffy_Pillow 28.0/130: 22% fury raid_movement, momentum
1:50.453 auto_attack Fluffy_Pillow 53.0/130: 41% fury momentum
1:50.453 blade_dance Fluffy_Pillow 53.0/130: 41% fury momentum
1:51.807 throw_glaive Fluffy_Pillow 18.0/130: 14% fury momentum
1:53.164 Waiting 0.900 sec 18.0/130: 14% fury momentum
1:54.064 consume_magic Fluffy_Pillow 18.0/130: 14% fury
1:54.064 vengeful_retreat Fluffy_Pillow 68.0/130: 52% fury
1:54.064 Waiting 0.800 sec 68.0/130: 52% fury momentum, vengeful_retreat_movement
1:54.864 eye_beam Fluffy_Pillow 68.0/130: 52% fury momentum, vengeful_retreat_movement
1:57.206 auto_attack Fluffy_Pillow 18.0/130: 14% fury momentum
1:57.206 Waiting 0.600 sec 18.0/130: 14% fury momentum
1:57.806 chaos_strike Fluffy_Pillow 84.0/130: 65% fury momentum
1:59.161 throw_glaive Fluffy_Pillow 64.0/130: 49% fury
2:00.766 blade_dance Fluffy_Pillow 64.0/130: 49% fury
2:02.120 Waiting 0.100 sec 29.0/130: 22% fury
2:02.220 fury_of_the_illidari Fluffy_Pillow 29.0/130: 22% fury
2:03.783 chaos_strike Fluffy_Pillow 95.0/130: 73% fury
2:05.139 auto_attack Fluffy_Pillow 75.0/130: 58% fury
2:05.139 fel_rush Fluffy_Pillow 75.0/130: 58% fury
2:05.496 chaos_strike Fluffy_Pillow 100.0/130: 77% fury momentum
2:06.853 Waiting 0.700 sec 60.0/130: 46% fury momentum
2:07.553 chaos_strike Fluffy_Pillow 125.0/130: 96% fury momentum
2:08.908 throw_glaive Fluffy_Pillow 85.0/130: 65% fury momentum
2:10.264 chaos_strike Fluffy_Pillow 85.0/130: 65% fury
2:11.619 chaos_strike Fluffy_Pillow 45.0/130: 35% fury
2:12.974 Waiting 1.600 sec 25.0/130: 19% fury
2:14.574 chaos_strike Fluffy_Pillow 61.0/130: 47% fury
2:15.929 Waiting 0.900 sec 21.0/130: 16% fury
2:16.829 fel_rush Fluffy_Pillow 21.0/130: 16% fury
2:17.191 chaos_strike Fluffy_Pillow 46.0/130: 35% fury momentum
2:18.546 fel_barrage Fluffy_Pillow 6.0/130: 5% fury momentum
2:20.107 throw_glaive Fluffy_Pillow 6.0/130: 5% fury raid_movement, momentum
2:21.464 auto_attack Fluffy_Pillow 6.0/130: 5% fury blood_frenzy
2:21.464 vengeful_retreat Fluffy_Pillow 6.0/130: 5% fury blood_frenzy
2:21.464 Waiting 0.600 sec 6.0/130: 5% fury momentum, vengeful_retreat_movement, blood_frenzy
2:22.064 blade_dance Fluffy_Pillow 40.0/130: 31% fury momentum, vengeful_retreat_movement, blood_frenzy
2:23.323 Waiting 2.200 sec 5.0/130: 4% fury momentum, blood_frenzy
2:25.523 fel_rush Fluffy_Pillow 44.0/130: 34% fury blood_frenzy
2:25.970 throw_glaive Fluffy_Pillow 69.0/130: 53% fury momentum, blood_frenzy
2:27.256 Waiting 1.300 sec 69.0/130: 53% fury momentum, blood_frenzy
2:28.556 chaos_strike Fluffy_Pillow 105.0/130: 81% fury momentum, blood_frenzy
2:29.817 Waiting 0.400 sec 65.0/130: 50% fury blood_frenzy
2:30.217 blade_dance Fluffy_Pillow 65.0/130: 50% fury
2:31.822 Waiting 0.300 sec 30.0/130: 23% fury
2:32.122 consume_magic Fluffy_Pillow 30.0/130: 23% fury
2:32.122 chaos_strike Fluffy_Pillow 80.0/130: 62% fury
2:33.479 Waiting 1.000 sec 60.0/130: 46% fury
2:34.479 throw_glaive Fluffy_Pillow 60.0/130: 46% fury
2:36.050 fel_rush Fluffy_Pillow 60.0/130: 46% fury raid_movement, blood_frenzy
2:36.426 Waiting 0.600 sec 85.0/130: 65% fury raid_movement, momentum, blood_frenzy
2:37.026 auto_attack Fluffy_Pillow 85.0/130: 65% fury momentum, blood_frenzy
2:37.026 chaos_strike Fluffy_Pillow 85.0/130: 65% fury momentum, blood_frenzy
2:38.285 Waiting 0.700 sec 65.0/130: 50% fury momentum, blood_frenzy
2:38.985 blade_dance Fluffy_Pillow 65.0/130: 50% fury momentum, blood_frenzy
2:40.398 Waiting 1.000 sec 30.0/130: 23% fury blood_frenzy
2:41.398 chaos_strike Fluffy_Pillow 59.0/130: 45% fury blood_frenzy
2:42.659 Waiting 0.900 sec 19.0/130: 15% fury blood_frenzy
2:43.559 chaos_strike Fluffy_Pillow 85.0/130: 65% fury blood_frenzy
2:44.818 chaos_strike Fluffy_Pillow 45.0/130: 35% fury blood_frenzy
2:46.079 Waiting 0.200 sec 5.0/130: 4% fury blood_frenzy
2:46.279 vengeful_retreat Fluffy_Pillow 5.0/130: 4% fury blood_frenzy
2:46.464 fel_barrage Fluffy_Pillow 5.0/130: 4% fury momentum, vengeful_retreat_movement, blood_frenzy
2:47.999 chaos_strike Fluffy_Pillow 72.0/130: 55% fury momentum
2:49.354 chaos_strike Fluffy_Pillow 52.0/130: 40% fury momentum
2:50.710 fel_rush Fluffy_Pillow 12.0/130: 9% fury raid_movement
2:51.078 throw_glaive Fluffy_Pillow 37.0/130: 28% fury raid_movement, momentum
2:52.433 throw_glaive Fluffy_Pillow 37.0/130: 28% fury raid_movement, momentum
2:53.787 auto_attack Fluffy_Pillow 37.0/130: 28% fury momentum, blood_frenzy
2:53.787 blade_dance Fluffy_Pillow 37.0/130: 28% fury momentum, blood_frenzy
2:55.045 fel_rush Fluffy_Pillow 2.0/130: 2% fury blood_frenzy
2:55.498 blur Fluffy_Pillow 27.0/130: 21% fury momentum, blood_frenzy
2:55.498 Waiting 0.500 sec 27.0/130: 21% fury blur, momentum, blood_frenzy
2:55.998 eye_beam Fluffy_Pillow 93.0/130: 72% fury blur, momentum, blood_frenzy
2:57.908 Waiting 1.200 sec 43.0/130: 33% fury metamorphosis, blur, momentum, blood_frenzy
2:59.108 fel_rush Fluffy_Pillow 70.0/130: 54% fury blur, blood_frenzy
2:59.461 chaos_strike Fluffy_Pillow 95.0/130: 73% fury blur, momentum, blood_frenzy
3:00.719 throw_glaive Fluffy_Pillow 55.0/130: 42% fury blur, momentum, blood_frenzy
3:01.981 blade_dance Fluffy_Pillow 55.0/130: 42% fury blur, momentum, blood_frenzy
3:03.422 fury_of_the_illidari Fluffy_Pillow 20.0/130: 15% fury blur
3:04.776 Waiting 2.500 sec 20.0/130: 15% fury blur
3:07.276 chaos_strike Fluffy_Pillow 110.0/130: 85% fury
3:08.631 throw_glaive Fluffy_Pillow 90.0/130: 69% fury raid_movement
3:10.062 auto_attack Fluffy_Pillow 90.0/130: 69% fury blood_frenzy
3:10.062 consume_magic Fluffy_Pillow 90.0/130: 69% fury blood_frenzy
3:10.062 chaos_strike Fluffy_Pillow 130.0/130: 100% fury blood_frenzy
3:11.324 vengeful_retreat Fluffy_Pillow 90.0/130: 69% fury blood_frenzy
3:11.464 chaos_strike Fluffy_Pillow 90.0/130: 69% fury momentum, vengeful_retreat_movement, blood_frenzy
3:12.726 chaos_strike Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
3:13.986 Waiting 0.500 sec 30.0/130: 23% fury momentum, blood_frenzy
3:14.486 chaos_strike Fluffy_Pillow 95.0/130: 73% fury momentum, blood_frenzy
3:15.747 fel_rush Fluffy_Pillow 75.0/130: 58% fury blood_frenzy
3:16.151 chaos_strike Fluffy_Pillow 100.0/130: 77% fury momentum, blood_frenzy
3:17.410 chaos_strike Fluffy_Pillow 60.0/130: 46% fury momentum, blood_frenzy
3:18.671 Waiting 0.100 sec 20.0/130: 15% fury momentum, blood_frenzy
3:18.771 chaos_strike Fluffy_Pillow 51.0/130: 39% fury momentum, blood_frenzy
3:20.031 throw_glaive Fluffy_Pillow 11.0/130: 8% fury raid_movement, blood_frenzy
3:21.291 Waiting 1.700 sec 11.0/130: 8% fury raid_movement, blood_frenzy
3:22.991 auto_attack Fluffy_Pillow 11.0/130: 8% fury blood_frenzy
3:22.991 Waiting 1.100 sec 11.0/130: 8% fury blood_frenzy
3:24.091 fel_rush Fluffy_Pillow 11.0/130: 8% fury raid_movement, blood_frenzy
3:24.438 Waiting 0.600 sec 36.0/130: 28% fury raid_movement, momentum
3:25.038 auto_attack Fluffy_Pillow 36.0/130: 28% fury momentum
3:25.038 blade_dance Fluffy_Pillow 36.0/130: 28% fury momentum
3:26.394 throw_glaive Fluffy_Pillow 1.0/130: 1% fury momentum
3:27.748 consume_magic Fluffy_Pillow 1.0/130: 1% fury momentum
3:27.748 Waiting 0.400 sec 51.0/130: 39% fury momentum
3:28.148 fel_rush Fluffy_Pillow 51.0/130: 39% fury
3:28.537 chaos_strike Fluffy_Pillow 76.0/130: 58% fury momentum
3:29.892 Waiting 2.200 sec 36.0/130: 28% fury momentum
3:32.092 chaos_strike Fluffy_Pillow 100.0/130: 77% fury momentum
3:33.447 Waiting 0.400 sec 60.0/130: 46% fury
3:33.847 blade_dance Fluffy_Pillow 60.0/130: 46% fury
3:35.404 throw_glaive Fluffy_Pillow 25.0/130: 19% fury
3:36.759 vengeful_retreat Fluffy_Pillow 25.0/130: 19% fury
3:36.759 Waiting 4.200 sec 25.0/130: 19% fury momentum, vengeful_retreat_movement
3:40.959 auto_attack Fluffy_Pillow 25.0/130: 19% fury
3:40.959 Waiting 2.400 sec 25.0/130: 19% fury
3:43.359 chaos_strike Fluffy_Pillow 93.0/130: 72% fury blood_frenzy
3:44.617 chaos_strike Fluffy_Pillow 53.0/130: 41% fury blood_frenzy
3:45.878 fel_rush Fluffy_Pillow 13.0/130: 10% fury blood_frenzy
3:46.312 consume_magic Fluffy_Pillow 38.0/130: 29% fury momentum, blood_frenzy
3:46.312 chaos_strike Fluffy_Pillow 88.0/130: 68% fury momentum, blood_frenzy
3:47.571 chaos_strike Fluffy_Pillow 68.0/130: 52% fury momentum, blood_frenzy
3:48.833 Waiting 1.100 sec 28.0/130: 22% fury momentum, blood_frenzy
3:49.933 chaos_strike Fluffy_Pillow 100.0/130: 77% fury blood_frenzy
3:51.193 throw_glaive Fluffy_Pillow 60.0/130: 46% fury raid_movement, blood_frenzy
3:52.453 throw_glaive Fluffy_Pillow 60.0/130: 46% fury raid_movement, blood_frenzy
3:53.713 auto_attack Fluffy_Pillow 60.0/130: 46% fury
3:53.713 blade_dance Fluffy_Pillow 60.0/130: 46% fury
3:55.068 Waiting 0.900 sec 25.0/130: 19% fury
3:55.968 fel_rush Fluffy_Pillow 25.0/130: 19% fury
3:56.389 Waiting 0.600 sec 50.0/130: 38% fury raid_movement, momentum, blood_frenzy
3:56.989 auto_attack Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
3:56.989 eye_beam Fluffy_Pillow 50.0/130: 38% fury momentum, blood_frenzy
3:58.788 Waiting 0.300 sec 0.0/130: 0% fury metamorphosis, momentum, blood_frenzy
3:59.088 fel_barrage Fluffy_Pillow 0.0/130: 0% fury momentum, blood_frenzy
4:00.635 auto_attack Fluffy_Pillow 0.0/130: 0% fury blood_frenzy
4:00.635 throw_glaive Fluffy_Pillow 0.0/130: 0% fury blood_frenzy
4:01.897 vengeful_retreat Fluffy_Pillow 0.0/130: 0% fury blood_frenzy
4:01.897 Waiting 1.300 sec 0.0/130: 0% fury momentum, vengeful_retreat_movement, blood_frenzy
4:03.197 fury_of_the_illidari Fluffy_Pillow 0.0/130: 0% fury momentum, blood_frenzy
4:04.684 blade_dance Fluffy_Pillow 68.0/130: 52% fury momentum, blood_frenzy
4:05.945 Waiting 0.100 sec 33.0/130: 25% fury blood_frenzy
4:06.045 fel_rush Fluffy_Pillow 33.0/130: 25% fury blood_frenzy
4:06.440 Waiting 1.700 sec 58.0/130: 45% fury momentum, blood_frenzy
4:08.140 consume_magic Fluffy_Pillow 71.0/130: 55% fury momentum, blood_frenzy
4:08.140 metamorphosis Fluffy_Pillow 121.0/130: 93% fury momentum, blood_frenzy
4:09.197 potion Fluffy_Pillow 121.0/130: 93% fury metamorphosis, momentum, blood_frenzy
4:09.197 throw_glaive Fluffy_Pillow 121.0/130: 93% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:10.205 annihilation Fluffy_Pillow 121.0/130: 93% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:11.215 annihilation Fluffy_Pillow 81.0/130: 62% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:12.224 Waiting 0.800 sec 61.0/130: 47% fury raid_movement, metamorphosis, blood_frenzy, potion_of_the_old_war
4:13.024 auto_attack Fluffy_Pillow 61.0/130: 47% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:13.024 annihilation Fluffy_Pillow 61.0/130: 47% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:14.034 Waiting 0.800 sec 21.0/130: 16% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:14.834 annihilation Fluffy_Pillow 71.0/130: 55% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:15.842 annihilation Fluffy_Pillow 51.0/130: 39% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:16.852 fel_rush Fluffy_Pillow 11.0/130: 8% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:17.222 Waiting 1.100 sec 36.0/130: 28% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:18.322 annihilation Fluffy_Pillow 87.0/130: 67% fury metamorphosis, momentum, potion_of_the_old_war
4:19.406 annihilation Fluffy_Pillow 67.0/130: 52% fury metamorphosis, momentum, potion_of_the_old_war
4:20.492 throw_glaive Fluffy_Pillow 47.0/130: 36% fury raid_movement, metamorphosis, momentum, potion_of_the_old_war
4:21.577 Waiting 1.400 sec 47.0/130: 36% fury raid_movement, metamorphosis, potion_of_the_old_war
4:22.977 auto_attack Fluffy_Pillow 47.0/130: 36% fury metamorphosis, potion_of_the_old_war
4:22.977 death_sweep Fluffy_Pillow 47.0/130: 36% fury metamorphosis, potion_of_the_old_war
4:24.063 consume_magic Fluffy_Pillow 12.0/130: 9% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:24.063 Waiting 0.700 sec 62.0/130: 48% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:24.763 annihilation Fluffy_Pillow 94.0/130: 72% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:25.772 Waiting 0.700 sec 54.0/130: 42% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:26.472 annihilation Fluffy_Pillow 87.0/130: 67% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:27.480 vengeful_retreat Fluffy_Pillow 67.0/130: 52% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:27.480 fel_barrage Fluffy_Pillow 67.0/130: 52% fury metamorphosis, momentum, vengeful_retreat_movement, blood_frenzy, potion_of_the_old_war
4:28.715 throw_glaive Fluffy_Pillow 67.0/130: 52% fury raid_movement, metamorphosis, momentum, out_of_range, blood_frenzy, potion_of_the_old_war
4:29.725 auto_attack Fluffy_Pillow 67.0/130: 52% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:29.725 death_sweep Fluffy_Pillow 67.0/130: 52% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:30.735 throw_glaive Fluffy_Pillow 32.0/130: 25% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:31.744 fel_rush Fluffy_Pillow 32.0/130: 25% fury metamorphosis, blood_frenzy, potion_of_the_old_war
4:32.180 Waiting 1.100 sec 57.0/130: 44% fury metamorphosis, momentum, blood_frenzy, potion_of_the_old_war
4:33.280 annihilation Fluffy_Pillow 86.0/130: 66% fury metamorphosis, momentum, potion_of_the_old_war
4:34.365 Waiting 0.700 sec 66.0/130: 51% fury metamorphosis, momentum
4:35.065 death_sweep Fluffy_Pillow 66.0/130: 51% fury metamorphosis, momentum
4:36.329 Waiting 0.700 sec 48.0/130: 37% fury metamorphosis
4:37.029 annihilation Fluffy_Pillow 77.0/130: 59% fury metamorphosis
4:38.115 Waiting 0.100 sec 37.0/130: 28% fury metamorphosis
4:38.215 throw_glaive Fluffy_Pillow 37.0/130: 28% fury
4:39.571 Waiting 1.700 sec 37.0/130: 28% fury
4:41.271 chaos_strike Fluffy_Pillow 79.0/130: 61% fury
4:42.628 fel_rush Fluffy_Pillow 59.0/130: 45% fury
4:43.041 chaos_strike Fluffy_Pillow 84.0/130: 65% fury momentum
4:44.396 Waiting 0.200 sec 44.0/130: 34% fury raid_movement, momentum
4:44.596 throw_glaive Fluffy_Pillow 44.0/130: 34% fury raid_movement, momentum
4:46.150 auto_attack Fluffy_Pillow 44.0/130: 34% fury momentum
4:46.150 chaos_strike Fluffy_Pillow 44.0/130: 34% fury momentum
4:47.507 Waiting 1.000 sec 24.0/130: 18% fury
4:48.507 chaos_strike Fluffy_Pillow 89.0/130: 68% fury
4:49.862 consume_magic Fluffy_Pillow 69.0/130: 53% fury
4:49.862 chaos_strike Fluffy_Pillow 119.0/130: 92% fury
4:51.217 Waiting 1.100 sec 79.0/130: 61% fury raid_movement
4:52.317 vengeful_retreat Fluffy_Pillow 79.0/130: 61% fury raid_movement
4:52.480 auto_attack Fluffy_Pillow 79.0/130: 61% fury momentum, vengeful_retreat_movement
4:52.480 blade_dance Fluffy_Pillow 79.0/130: 61% fury momentum, vengeful_retreat_movement
4:53.835 throw_glaive Fluffy_Pillow 44.0/130: 34% fury momentum
4:55.189 Waiting 1.300 sec 44.0/130: 34% fury momentum
4:56.489 fel_rush Fluffy_Pillow 44.0/130: 34% fury
4:56.905 eye_beam Fluffy_Pillow 69.0/130: 53% fury momentum
4:58.981 auto_attack Fluffy_Pillow 19.0/130: 15% fury momentum
4:58.981 fel_barrage Fluffy_Pillow 19.0/130: 15% fury momentum
5:00.540 Waiting 0.500 sec 19.0/130: 15% fury raid_movement
5:01.040 auto_attack Fluffy_Pillow 19.0/130: 15% fury
5:01.040 Waiting 0.600 sec 19.0/130: 15% fury
5:01.640 blade_dance Fluffy_Pillow 63.0/130: 48% fury
5:02.997 throw_glaive Fluffy_Pillow 28.0/130: 22% fury
5:04.351 fury_of_the_illidari Fluffy_Pillow 28.0/130: 22% fury
5:05.707 Waiting 0.800 sec 28.0/130: 22% fury
5:06.507 fel_rush Fluffy_Pillow 42.0/130: 32% fury blood_frenzy
5:06.907 Waiting 1.500 sec 67.0/130: 52% fury momentum, blood_frenzy
5:08.407 chaos_strike Fluffy_Pillow 81.0/130: 62% fury momentum, blood_frenzy
5:09.668 Waiting 0.400 sec 41.0/130: 32% fury momentum, blood_frenzy
5:10.068 chaos_strike Fluffy_Pillow 41.0/130: 32% fury momentum, blood_frenzy
5:11.329 Waiting 1.500 sec 21.0/130: 16% fury blood_frenzy
5:12.829 chaos_strike Fluffy_Pillow 54.0/130: 42% fury blood_frenzy
5:14.091 Waiting 0.900 sec 34.0/130: 26% fury blood_frenzy
5:14.991 chaos_strike Fluffy_Pillow 60.0/130: 46% fury blood_frenzy
5:16.251 throw_glaive Fluffy_Pillow 20.0/130: 15% fury raid_movement
5:17.606 auto_attack Fluffy_Pillow 20.0/130: 15% fury
5:17.606 vengeful_retreat Fluffy_Pillow 20.0/130: 15% fury
5:17.606 Waiting 2.000 sec 20.0/130: 15% fury momentum, vengeful_retreat_movement
5:19.606 throw_glaive Fluffy_Pillow 20.0/130: 15% fury momentum
5:21.164 Waiting 0.500 sec 20.0/130: 15% fury momentum
5:21.664 fel_rush Fluffy_Pillow 20.0/130: 15% fury
5:22.087 chaos_strike Fluffy_Pillow 45.0/130: 35% fury momentum
5:23.442 Waiting 1.200 sec 5.0/130: 4% fury momentum
5:24.642 chaos_strike Fluffy_Pillow 76.0/130: 58% fury momentum
5:25.996 Waiting 3.400 sec 36.0/130: 28% fury
5:29.396 chaos_strike Fluffy_Pillow 80.0/130: 62% fury
5:30.753 consume_magic Fluffy_Pillow 40.0/130: 31% fury
5:30.753 chaos_strike Fluffy_Pillow 90.0/130: 69% fury
5:32.108 fel_rush Fluffy_Pillow 50.0/130: 38% fury raid_movement, blood_frenzy
5:32.528 throw_glaive Fluffy_Pillow 75.0/130: 58% fury raid_movement, momentum, blood_frenzy
5:33.787 auto_attack Fluffy_Pillow 75.0/130: 58% fury momentum, blood_frenzy
5:33.787 chaos_strike Fluffy_Pillow 75.0/130: 58% fury momentum, blood_frenzy
5:35.048 chaos_strike Fluffy_Pillow 55.0/130: 42% fury momentum, blood_frenzy
5:36.311 fel_rush Fluffy_Pillow 15.0/130: 12% fury blood_frenzy
5:36.705 chaos_strike Fluffy_Pillow 40.0/130: 31% fury momentum, blood_frenzy
5:37.965 throw_glaive Fluffy_Pillow 0.0/130: 0% fury momentum, blood_frenzy
5:39.225 fel_barrage Fluffy_Pillow 0.0/130: 0% fury momentum, blood_frenzy
5:40.733 Waiting 1.700 sec 0.0/130: 0% fury blood_frenzy
5:42.433 vengeful_retreat Fluffy_Pillow 0.0/130: 0% fury
5:42.606 Waiting 0.100 sec 0.0/130: 0% fury momentum, vengeful_retreat_movement
5:42.706 eye_beam Fluffy_Pillow 61.0/130: 47% fury momentum, vengeful_retreat_movement
5:44.747 Waiting 0.300 sec 11.0/130: 8% fury momentum
5:45.047 chaos_strike Fluffy_Pillow 73.0/130: 56% fury momentum
5:46.403 throw_glaive Fluffy_Pillow 53.0/130: 41% fury momentum
5:47.976 chaos_strike Fluffy_Pillow 53.0/130: 41% fury
5:49.330 auto_attack Fluffy_Pillow 13.0/130: 10% fury
5:49.330 fel_rush Fluffy_Pillow 13.0/130: 10% fury
5:49.755 Waiting 3.600 sec 38.0/130: 29% fury momentum
5:53.355 fel_rush Fluffy_Pillow 38.0/130: 29% fury
5:53.707 blur Fluffy_Pillow 63.0/130: 48% fury momentum
5:53.707 chaos_strike Fluffy_Pillow 63.0/130: 48% fury blur, momentum
5:55.063 chaos_strike Fluffy_Pillow 43.0/130: 33% fury blur, momentum
5:56.419 throw_glaive Fluffy_Pillow 23.0/130: 18% fury blur, momentum
5:57.774 fel_rush Fluffy_Pillow 23.0/130: 18% fury blur
5:58.223 chaos_strike Fluffy_Pillow 48.0/130: 37% fury blur, momentum
5:59.579 Waiting 3.900 sec 28.0/130: 22% fury blur, momentum
6:03.479 chaos_strike Fluffy_Pillow 84.0/130: 65% fury blur
6:04.835 throw_glaive Fluffy_Pillow 64.0/130: 49% fury raid_movement
6:06.191 auto_attack Fluffy_Pillow 64.0/130: 49% fury
6:06.191 fury_of_the_illidari Fluffy_Pillow 64.0/130: 49% fury
6:07.546 vengeful_retreat Fluffy_Pillow 64.0/130: 49% fury
6:07.606 chaos_strike Fluffy_Pillow 64.0/130: 49% fury momentum, vengeful_retreat_movement
6:08.960 Waiting 1.800 sec 24.0/130: 18% fury momentum, blood_frenzy
6:10.760 chaos_strike Fluffy_Pillow 88.0/130: 68% fury momentum, blood_frenzy
6:12.023 consume_magic Fluffy_Pillow 48.0/130: 37% fury blood_frenzy
6:12.023 fel_rush Fluffy_Pillow 98.0/130: 75% fury blood_frenzy
6:12.458 chaos_strike Fluffy_Pillow 123.0/130: 95% fury momentum, blood_frenzy
6:13.720 throw_glaive Fluffy_Pillow 83.0/130: 64% fury momentum, blood_frenzy
6:14.981 chaos_strike Fluffy_Pillow 83.0/130: 64% fury momentum, blood_frenzy
6:16.242 chaos_strike Fluffy_Pillow 63.0/130: 48% fury blood_frenzy
6:17.502 Waiting 2.000 sec 23.0/130: 18% fury blood_frenzy
6:19.502 chaos_strike Fluffy_Pillow 84.0/130: 65% fury
6:20.860 fel_rush Fluffy_Pillow 64.0/130: 49% fury raid_movement
6:21.274 auto_attack Fluffy_Pillow 89.0/130: 68% fury momentum
6:21.274 chaos_strike Fluffy_Pillow 89.0/130: 68% fury momentum
6:22.630 throw_glaive Fluffy_Pillow 69.0/130: 53% fury momentum
6:23.985 chaos_strike Fluffy_Pillow 69.0/130: 53% fury momentum
6:25.340 fel_rush Fluffy_Pillow 49.0/130: 38% fury
6:25.727 chaos_strike Fluffy_Pillow 74.0/130: 57% fury momentum
6:27.085 Waiting 1.300 sec 34.0/130: 26% fury momentum
6:28.385 eye_beam Fluffy_Pillow 89.0/130: 68% fury momentum
6:30.344 Waiting 0.400 sec 39.0/130: 30% fury metamorphosis
6:30.744 chaos_strike Fluffy_Pillow 95.0/130: 73% fury
6:32.100 chaos_strike Fluffy_Pillow 55.0/130: 42% fury
6:33.456 vengeful_retreat Fluffy_Pillow 35.0/130: 27% fury
6:33.456 fel_barrage Fluffy_Pillow 35.0/130: 27% fury momentum, vengeful_retreat_movement
6:35.095 throw_glaive Fluffy_Pillow 35.0/130: 27% fury momentum

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 26060 24354 14163 (10117)
Stamina 34498 34498 21395
Intellect 5328 5003 0
Spirit 2 2 0
Health 2069880 2069880 0
Fury 130 130 0
Crit 43.18% 42.11% 9139
Haste 10.96% 10.96% 3562
Damage / Heal Versatility 2.18% 2.18% 873
Attack Power 26060 24354 0
Mastery 21.31% 21.31% 4659
Armor 2086 2086 2086
Run Speed 8 0 0
Leech 1.37% 1.37% 314

Gear

Source Slot Average Item Level: 863.00
Local Head Dreadhide Hood
ilevel: 860, stats: { 276 Armor, +1424 AgiInt, +2136 Sta, +794 Crit, +561 Haste }
Local Neck Prydaz, Xavaric's Magnum Opus
ilevel: 895, stats: { +1665 Sta, +1397 Mastery, +776 Crit }
Local Shoulders Swordsinger's Shoulders
ilevel: 865, stats: { 259 Armor, +1119 AgiInt, +1678 Sta, +702 Mastery, +333 Haste }
Local Chest Chestguard of Insidious Desire
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +792 Crit, +512 Mastery }
Local Waist Forest-Lord's Waistwrap
ilevel: 865, stats: { 195 Armor, +1678 Sta, +1119 AgiInt, +673 Haste, +362 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 865, stats: { 303 Armor, +2237 Sta, +1491 AgiInt, +986 Crit, +394 Mastery }
Local Feet Biornskin Moccasins
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Mastery }
Local Wrists Dragonspur Wristguards
ilevel: 855, stats: { 146 Armor, +1147 Sta, +765 AgiInt, +518 Crit, +230 Haste }
Local Hands Mana-Lanced Gloves
ilevel: 870, stats: { 220 Armor, +1172 AgiInt, +1758 Sta, +640 Vers, +414 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste, +314 Leech }, enchant: { +150 Crit }
Local Finger2 Ring of Frozen Magic
ilevel: 870, stats: { +1319 Sta, +1188 Haste, +791 Crit }, enchant: { +150 Crit }
Local Trinket1 Three-Toed Rabbit Foot
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }, enchant: { +150 Agi }
Local Main Hand Twinblades of the Deceiver
ilevel: 877, weapon: { 4237 - 7872, 2.6 }, stats: { +715 Agi, +1072 Sta, +314 Crit, +302 Mastery }, relics: { +40 ilevels, +45 ilevels, +42 ilevels }
Local Off Hand Twinblades of the Deceiver
ilevel: 877, weapon: { 4237 - 7872, 2.6 }, stats: { +715 Agi, +1072 Sta, +314 Crit, +302 Mastery }

Talents

Level
15 Fel Mastery (Havoc Demon Hunter) Chaos Cleave (Havoc Demon Hunter) Blind Fury (Havoc Demon Hunter)
30 Prepared (Havoc Demon Hunter) Demon Blades (Havoc Demon Hunter) Demonic Appetite (Havoc Demon Hunter)
45 Felblade First Blood (Havoc Demon Hunter) Bloodlet (Havoc Demon Hunter)
60 Netherwalk (Havoc Demon Hunter) Desperate Instincts (Havoc Demon Hunter) Soul Rending (Havoc Demon Hunter)
75 Momentum (Havoc Demon Hunter) Fel Eruption (Havoc Demon Hunter) Nemesis (Havoc Demon Hunter)
90 Master of the Glaive (Havoc Demon Hunter) Unleashed Power (Havoc Demon Hunter) Demon Reborn (Havoc Demon Hunter)
100 Chaos Blades (Havoc Demon Hunter) Fel Barrage (Havoc Demon Hunter) Demonic (Havoc Demon Hunter)

Profile

demonhunter="Táunks"
origin="https://us.api.battle.net/wow/character/thrall/Táunks/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/107/157266795-avatar.jpg"
level=110
race=blood_elf
role=attack
position=back
professions=mining=1/skinning=800
talents=1233112
talent_override=fel_barrage,if=active_enemies>1|raid_event.adds.exists
artifact=3:0:0:0:0:1000:3:1001:3:1002:3:1003:3:1004:3:1006:3:1007:3:1010:1:1011:1:1012:1:1013:1:1014:1:1016:1:1330:1
spec=havoc

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/metamorphosis

# Executed every time the actor is available.
actions=auto_attack
# "Getting ready to use meta" conditions, this is used in a few places.
actions+=/variable,name=pooling_for_meta,value=cooldown.metamorphosis.ready&buff.metamorphosis.down&(!talent.demonic.enabled|!cooldown.eye_beam.ready)&(!talent.chaos_blades.enabled|cooldown.chaos_blades.ready)&(!talent.nemesis.enabled|debuff.nemesis.up|cooldown.nemesis.ready)
# Blade Dance conditions. Always if First Blood is talented, otherwise 3+ targets with Chaos Cleave or 2+ targets without.
actions+=/variable,name=blade_dance,value=talent.first_blood.enabled|spell_targets.blade_dance1>=2+talent.chaos_cleave.enabled
# Blade Dance pooling condition, so we don't spend too much fury when we need it soon. No need to pool on
# single target since First Blood already makes it cheap enough and delaying it a tiny bit isn't a big deal.
actions+=/variable,name=pooling_for_blade_dance,value=variable.blade_dance&fury-40<35-talent.first_blood.enabled*20&spell_targets.blade_dance1>=2
actions+=/blur,if=artifact.demon_speed.enabled&cooldown.fel_rush.charges_fractional<0.5&cooldown.vengeful_retreat.remains-buff.momentum.remains>4
actions+=/call_action_list,name=cooldown
# Fel Rush in at the start of combat.
actions+=/fel_rush,animation_cancel=1,if=time=0
actions+=/pick_up_fragment,if=talent.demonic_appetite.enabled&fury.deficit>=30
actions+=/consume_magic
# Vengeful Retreat backwards through the target to minimize downtime.
actions+=/vengeful_retreat,if=(talent.prepared.enabled|talent.momentum.enabled)&buff.prepared.down&buff.momentum.down
# Fel Rush for Momentum and for fury from Fel Mastery.
actions+=/fel_rush,animation_cancel=1,if=(talent.momentum.enabled|talent.fel_mastery.enabled)&(!talent.momentum.enabled|(charges=2|cooldown.vengeful_retreat.remains>4)&buff.momentum.down)&(!talent.fel_mastery.enabled|fury.deficit>=25)&(charges=2|(raid_event.movement.in>10&raid_event.adds.in>10))
# Use Fel Barrage at max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges>=5&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.momentum.enabled|buff.momentum.up)&charges=2
actions+=/fury_of_the_illidari,if=active_enemies>desired_targets|raid_event.adds.in>55&(!talent.momentum.enabled|buff.momentum.up)
actions+=/eye_beam,if=talent.demonic.enabled&buff.metamorphosis.down&fury.deficit<30
actions+=/death_sweep,if=variable.blade_dance
actions+=/blade_dance,if=variable.blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&spell_targets>=2+talent.chaos_cleave.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&(spell_targets>=3|raid_event.adds.in>recharge_time+cooldown)
actions+=/fel_eruption
actions+=/felblade,if=fury.deficit>=30+buff.prepared.up*8
actions+=/annihilation,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8|buff.metamorphosis.remains<5)&!variable.pooling_for_blade_dance
actions+=/throw_glaive,if=talent.bloodlet.enabled&(!talent.master_of_the_glaive.enabled|!talent.momentum.enabled|buff.momentum.up)&raid_event.adds.in>recharge_time+cooldown
actions+=/eye_beam,if=!talent.demonic.enabled&((spell_targets.eye_beam_tick>desired_targets&active_enemies>1)|(raid_event.adds.in>45&!variable.pooling_for_meta&buff.metamorphosis.down&(artifact.anguish_of_the_deceiver.enabled|active_enemies>1)))
# If Demonic is talented, pool fury as Eye Beam is coming off cooldown.
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<gcd&fury.deficit>=20
actions+=/demons_bite,if=talent.demonic.enabled&buff.metamorphosis.down&cooldown.eye_beam.remains<2*gcd&fury.deficit>=45
actions+=/throw_glaive,if=buff.metamorphosis.down&spell_targets>=2
actions+=/chaos_strike,if=(talent.demon_blades.enabled|!talent.momentum.enabled|buff.momentum.up|fury.deficit<30+buff.prepared.up*8)&!variable.pooling_for_meta&!variable.pooling_for_blade_dance&(!talent.demonic.enabled|!cooldown.eye_beam.ready)
# Use Fel Barrage if its nearing max charges, saving it for Momentum and adds if possible.
actions+=/fel_barrage,if=charges=4&buff.metamorphosis.down&(buff.momentum.up|!talent.momentum.enabled)&(active_enemies>desired_targets|raid_event.adds.in>30)
actions+=/fel_rush,animation_cancel=1,if=!talent.momentum.enabled&raid_event.movement.in>charges*10
actions+=/demons_bite
actions+=/throw_glaive,if=buff.out_of_range.up|buff.raid_movement.up
actions+=/felblade,if=movement.distance|buff.out_of_range.up
actions+=/fel_rush,if=movement.distance>15|(buff.out_of_range.up&!talent.momentum.enabled)
actions+=/vengeful_retreat,if=movement.distance>15

actions.cooldown=nemesis,target_if=min:target.time_to_die,if=raid_event.adds.exists&debuff.nemesis.down&(active_enemies>desired_targets|raid_event.adds.in>60)
actions.cooldown+=/nemesis,if=!raid_event.adds.exists&(cooldown.metamorphosis.remains>100|target.time_to_die<70)
actions.cooldown+=/nemesis,sync=metamorphosis,if=!raid_event.adds.exists
actions.cooldown+=/chaos_blades,if=buff.metamorphosis.up|cooldown.metamorphosis.remains>100|target.time_to_die<20
actions.cooldown+=/metamorphosis,if=variable.pooling_for_meta&fury.deficit<30&(talent.chaos_blades.enabled|!cooldown.fury_of_the_illidari.ready)
actions.cooldown+=/potion,name=old_war,if=buff.metamorphosis.remains>25|target.time_to_die<30

head=dreadhide_hood,id=121296,bonus_id=3474/1522/3337
neck=prydaz_xavarics_magnum_opus,id=132444,bonus_id=1811/3458
shoulders=swordsingers_shoulders,id=134286,bonus_id=1727/1808/1527/3337
back=drape_of_the_manastarved,id=141543,bonus_id=1472,enchant=150agi
chest=chestguard_of_insidious_desire,id=137514,bonus_id=1727/1502/3336
wrists=dragonspur_wristguards,id=138219,bonus_id=1807/1477/3336
hands=manalanced_gloves,id=134444,bonus_id=1727/1808/1522/3337
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1487/3337
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1487/3337
feet=biornskin_moccasins,id=134193,bonus_id=3474/1507/1674
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/41/1472,enchant=150crit
finger2=ring_of_frozen_magic,id=141533,bonus_id=1482/3336,enchant=150crit
trinket1=threetoed_rabbit_foot,id=134203,bonus_id=3432/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150crit
main_hand=twinblades_of_the_deceiver,id=127829,bonus_id=719,gem_id=141277/141273/143687/0,relic_id=3432:1502:3336/3474:1517:3336/3474:1507:1674/0
off_hand=twinblades_of_the_deceiver,id=127830

# Gear Summary
# gear_ilvl=862.75
# gear_agility=14163
# gear_stamina=21395
# gear_crit_rating=9139
# gear_haste_rating=3562
# gear_mastery_rating=4659
# gear_versatility_rating=873
# gear_leech_rating=314
# gear_armor=2086

Illistan

Illistan : 205671 dps, 128922 dps to main target, 61420 dtps, 0 hps (0 aps), 61.6k TMI, 63.4k ETMI

  • Race: Blood Elf
  • Class: Demonhunter
  • Spec: Vengeance
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
205670.5 205670.5 210.2 / 0.102% 39413.2 / 19.2% 24407.1
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
61420.0 41.29 / 0.07% 8128 / 13.2%       61.6k 12 / 0.02% 59.1k 64.4k 2.5k / 4.0%       20.7% 13.1% 29.7% 19.7       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
8.4 8.4 Pain 3.70% 60.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Illistan/advanced
Talents
  • 15: Agonizing Flames (Vengeance Demon Hunter)
  • 30: Feast of Souls (Vengeance Demon Hunter)
  • 45: Felblade
  • 60: Feed the Demon (Vengeance Demon Hunter)
  • 75: Concentrated Sigils (Vengeance Demon Hunter)
  • 90: Fel Devastation (Vengeance Demon Hunter)
  • 100: Last Resort (Vengeance Demon Hunter)
  • Talent Calculator
Artifact
Professions
  • herbalism: 339
  • enchanting: 59
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Vers Haste
Scale Factors -0.32 -0.49 -0.58 -0.81 -0.82
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Vers ~= Haste
Pawn string ( Pawn: v1: "Illistan": Agility=-0.32, CritRating=-0.49, HasteRating=-0.82, MasteryRating=-0.58, Versatility=-0.81 )

Scale Factors for other metrics

Scale Factors for Illistan Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 7.80 4.76 4.53 4.11 3.24
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.26 0.26 0.26 0.26
Gear Ranking
Optimizers
Ranking
  • Agi > Vers ~= Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.80, CritRating=4.11, HasteRating=3.24, MasteryRating=4.53, Versatility=4.76 )
Scale Factors for Illistan Priority Target Damage Per Second
Agi Vers Mastery Crit Haste
Scale Factors 4.65 3.03 2.70 2.66 2.64
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery ~= Crit ~= Haste
Pawn string ( Pawn: v1: "Illistan": Agility=4.65, CritRating=2.66, HasteRating=2.64, MasteryRating=2.70, Versatility=3.03 )
Scale Factors for Illistan Damage Per Second (Effective)
Agi Vers Mastery Crit Haste
Scale Factors 7.80 4.76 4.53 4.11 3.24
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=7.80, CritRating=4.11, HasteRating=3.24, MasteryRating=4.53, Versatility=4.76 )
Scale Factors for Illistan Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Illistan": )
Scale Factors for Illistan Damage Taken Per Second
Agi Crit Mastery Vers Haste
Scale Factors -0.32 -0.49 -0.58 -0.81 -0.82
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.05 0.05 0.05 0.05 0.05
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Vers ~= Haste
Pawn string ( Pawn: v1: "Illistan": Agility=-0.32, CritRating=-0.49, HasteRating=-0.82, MasteryRating=-0.58, Versatility=-0.81 )
Scale Factors for Illistan Damage Taken
Agi Crit Mastery Vers Haste
Scale Factors -127.36 -199.74 -234.07 -326.37 -329.22
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Vers > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=-127.36, CritRating=-199.74, HasteRating=-329.22, MasteryRating=-234.07, Versatility=-326.37 )
Scale Factors for Illistan Healing Taken Per Second
Agi Crit Mastery Vers Haste
Scale Factors -0.30 -0.48 -0.56 -0.79 -0.79
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Mastery > Vers > Haste
Pawn string ( Pawn: v1: "Illistan": Agility=-0.30, CritRating=-0.48, HasteRating=-0.79, MasteryRating=-0.56, Versatility=-0.79 )
Scale Factors for Illistan Theck-Meloree Index
Agi Crit Haste Mastery Vers
Scale Factors -0.45 -0.28 -0.50 -0.35 -0.38
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.45, CritRating=-0.28, HasteRating=-0.50, MasteryRating=-0.35, Versatility=-0.38 )
Scale Factors for IllistanTheck-Meloree Index (Effective)
Agi Crit Haste Mastery Vers
Scale Factors -0.08 -0.06 -0.16 -0.09 -0.11
Normalized 0.00 0.00 0.00 0.00 0.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.01 0.01 0.01 0.01 0.01
Gear Ranking
Optimizers
Ranking
  • Agi > Crit > Haste > Mastery > Vers
Pawn string ( Pawn: v1: "Illistan": Agility=-0.08, CritRating=-0.06, HasteRating=-0.16, MasteryRating=-0.09, Versatility=-0.11 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Illistan 205671
auto_attack_mh 9758 4.8% 147.7 2.72sec 26472 12331 Direct 147.7 21364 42725 26472 42.9% 18.9% 6.1%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 147.73 147.73 0.00 0.00 2.1467 0.0000 3910815.36 5881622.86 33.51 12331.39 12331.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.22 35.35% 21854.78 21855 21855 21854.78 21855 21855 1141336 1677872 31.98
hit (blocked) 4.22 2.86% 15298.35 15298 15298 15036.72 0 15298 64582 135632 51.49
crit 58.55 39.64% 43709.57 43710 43710 43709.57 43710 43710 2559407 3762571 31.98
crit (blocked) 4.76 3.22% 30596.70 30597 30597 30284.58 0 30597 145490 305548 51.85
miss 27.98 18.94% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 4576 2.2% 138.5 2.90sec 13240 5764 Direct 138.5 10683 21365 13240 42.9% 19.0% 6.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 138.50 138.50 0.00 0.00 2.2971 0.0000 1833718.89 2757529.94 33.50 5763.78 5763.78
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.81 35.25% 10927.39 10927 10927 10927.39 10927 10927 533404 784154 31.98
hit (blocked) 3.93 2.84% 7649.17 7649 7649 7473.99 0 7649 30083 63178 51.18
crit 55.01 39.72% 21854.78 21855 21855 21854.78 21855 21855 1202243 1767411 31.98
crit (blocked) 4.44 3.21% 15298.35 15298 15298 15097.92 0 15298 67990 142787 51.70
miss 26.30 18.99% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Felblade 12335 6.0% 40.2 9.98sec 122696 91840 Direct 40.2 85820 171659 122696 43.0% 0.0% 7.5%  

Stats details: felblade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.23 40.23 0.00 0.00 1.3360 0.0000 4936193.08 4936193.08 0.00 91839.57 91839.57
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.25 52.81% 85820.20 84452 92897 85827.41 84452 88674 1823460 1823460 0.00
hit (blocked) 1.70 4.23% 85813.31 84452 92897 70182.42 0 92897 145915 145915 0.00
crit 15.97 39.71% 171654.62 168903 185794 171663.72 168903 178287 2742024 2742024 0.00
crit (blocked) 1.31 3.25% 171712.01 168903 185794 125619.41 0 185794 224794 224794 0.00
 
 

Action details: felblade

Static Values
  • id:232893
  • school:physical
  • resource:none
  • range:15.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=70
Spelldata
  • id:232893
  • name:Felblade
  • school:physical
  • tooltip:
  • description:Charge to your target and deal $213243sw2 Fire damage. {$?s203513=false}[Shear has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates ${{$213243s3=200}/10} Pain.|r][Demon's Bite has a chance to reset the cooldown of Felblade. |cFFFFFFFFGenerates {$213243s4=30} Fury.|r]
 
Fiery Brand 5640 2.8% 7.1 60.61sec 318999 0 Direct 7.1 223227 446453 318996 42.9% 0.0% 0.0%  

Stats details: fiery_brand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.07 7.07 6.96 0.00 0.0000 8.0000 2254881.08 2254881.08 0.00 40511.70 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.04 57.10% 223226.60 223227 223227 222668.47 0 223227 900921 900921 0.00
crit 3.03 42.90% 446453.19 446453 446453 437344.64 0 446453 1353960 1353960 0.00
 
 

Action details: fiery_brand

Static Values
  • id:204021
  • school:fire
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.demon_spikes.down&buff.metamorphosis.down
Spelldata
  • id:204021
  • name:Fiery Brand
  • school:fire
  • tooltip:Dealing {$s1=40}% less damage to the branding Demon Hunter.
  • description:Brand an enemy with a demonic symbol, instantly dealing $sw2 Fire damage and reducing the damage they do to you by {$s1=40}% for {$207744d=8 seconds}.
 
Immolation Aura 75084 36.3% 29.1 13.93sec 1021070 846224 Direct 696.9 29883 59790 42706 42.9% 0.0% 0.0%  

Stats details: immolation_aura

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.15 696.87 0.00 0.00 1.2067 0.0000 29760005.68 29760005.68 0.00 846224.00 846224.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 398.08 57.12% 29882.70 20152 95321 29894.22 25871 34153 11895787 11895787 0.00
crit 298.78 42.88% 59790.30 40305 190642 59814.36 49888 70216 17864218 17864218 0.00
 
 

Action details: immolation_aura

Static Values
  • id:178740
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:pain<=80
Spelldata
  • id:178740
  • name:Immolation Aura
  • school:fire
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
 
Infernal Strike 26076 12.6% 21.3 20.11sec 485459 0 Direct 71.7 100871 201747 144211 43.0% 0.0% 0.0%  

Stats details: infernal_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.29 71.66 0.00 0.00 0.0000 0.0000 10333779.23 10333779.23 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.87 57.04% 100871.36 99833 109817 100878.09 99833 102872 4122905 4122905 0.00
crit 30.79 42.96% 201746.97 199667 219633 201761.23 199667 206714 6210874 6210874 0.00
 
 

Action details: infernal_strike

Static Values
  • id:189110
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:1.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
Spelldata
  • id:189110
  • name:Infernal Strike
  • school:physical
  • tooltip:
  • description:Leap through the air toward a targeted location, dealing {$189112s1=1} Fire damage to all enemies within $189112a1 yards.
 
Shear 32923 16.1% 156.3 2.54sec 84322 63016 Direct 156.3 59028 118043 84322 42.9% 0.0% 7.5%  

Stats details: shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 156.35 156.35 0.00 0.00 1.3381 0.0000 13183479.92 19826324.78 33.51 63015.53 63015.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.67 52.87% 60380.31 60380 60380 60380.31 60380 60380 4991427 7337870 31.98
hit (blocked) 6.67 4.27% 42266.21 42266 42266 42190.13 0 42266 281923 592076 52.29
crit 61.98 39.64% 120760.61 120761 120761 120760.61 120761 120761 7485177 11003920 31.98
crit (blocked) 5.03 3.22% 84532.43 84532 84532 83873.01 0 84532 424953 892459 51.98
 
 

Action details: shear

Static Values
  • id:203782
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203782
  • name:Shear
  • school:physical
  • tooltip:
  • description:Shears an enemy for $sw2 Physical damage, and has a small chance to shatter a Lesser Soul Fragment from your target that heals you for {$203794s1=0} health when consumed. |cFFFFFFFFGenerates ${$m3/10} Pain.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.70
 
Sigil of Flame 11245 5.5% 13.3 31.01sec 335781 279728 Direct 34.9 52732 105440 75291 42.8% 0.0% 0.0%  
Periodic 69.0 18706 37412 26727 42.9% 0.0% 0.0% 34.5%

Stats details: sigil_of_flame

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.32 34.90 69.00 69.00 1.2004 2.0000 4472007.89 4472007.89 0.00 29041.28 279727.77
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.96 57.20% 52731.86 51156 56272 52650.55 51156 54993 1052766 1052766 0.00
crit 14.94 42.80% 105439.61 102312 112543 105283.52 102312 110270 1575074 1575074 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.4 57.12% 18706.07 18602 20462 18701.29 18602 19222 737299 737299 0.00
crit 29.6 42.88% 37412.24 37204 40925 37402.93 37204 38445 1106869 1106869 0.00
 
 

Action details: sigil_of_flame

Static Values
  • id:204596
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains-delay<=0.3*duration
Spelldata
  • id:204596
  • name:Sigil of Flame
  • school:physical
  • tooltip:Sigil of Flame is active.
  • description:Place a Sigil of Flame at the target location that activates after {$d=2 seconds}. Deals {$204598s1=0} Fire damage, and an additional $204598o2 Fire damage over {$204598d=6 seconds}, to all enemies affected by the sigil.
 
Soul Carver 9391 4.6% 7.1 60.65sec 531728 381957 Direct 14.1 109681 219599 156655 42.7% 0.0% 7.6%  
Periodic 21.1 51157 102315 73098 42.9% 0.0% 0.0% 5.3%

Stats details: soul_carver

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 14.12 21.10 21.10 1.3921 1.0000 3754641.85 3754641.85 0.00 121387.66 381957.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.47 52.87% 109674.20 73153 146307 109695.05 0 146307 818924 818924 0.00
hit (blocked) 0.62 4.40% 109765.38 73153 146307 51442.44 0 146307 68142 68142 0.00
crit 5.58 39.49% 219544.00 146307 292613 219170.26 0 292613 1224154 1224154 0.00
crit (blocked) 0.46 3.24% 220274.13 146307 292613 82700.09 0 292613 100918 100918 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.1 57.11% 51157.42 51157 51157 51157.42 51157 51157 616524 616524 0.00
crit 9.1 42.89% 102314.85 102315 102315 102304.61 0 102315 925981 925981 0.00
 
 

Action details: soul_carver

Static Values
  • id:207407
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.fiery_brand.ticking
Spelldata
  • id:207407
  • name:Soul Carver
  • school:fire
  • tooltip:Suffering {$s1=1} Fire damage every $t sec.
  • description:Carve into the soul of your target, dealing ${$sw2+$214743sw1} Fire damage and an additional ${3*{$s1=1}} Fire damage over {$d=3 seconds}. Immediately shatters {$s4=2} Lesser Soul Fragments from the target and 1 additional Lesser Soul Fragment every $t sec.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.350000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.41
 
Soul Cleave 18641 9.1% 44.3 8.99sec 168420 125003 Direct 44.3 117969 235879 168419 42.8% 0.0% 7.5%  

Stats details: soul_cleave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.34 44.34 0.00 0.00 1.3473 0.0000 7467694.30 11231499.69 33.51 125003.25 125003.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.47 52.93% 120675.61 60986 121869 120667.16 113645 121869 2832217 4163628 31.98
hit (blocked) 1.90 4.28% 84498.20 45205 85308 71778.42 0 85308 160369 336797 44.51
crit 17.54 39.56% 241343.24 121935 243737 241339.28 225095 243737 4233468 6223600 31.98
crit (blocked) 1.43 3.23% 168888.36 87422 170616 129424.59 0 170616 241640 507476 40.15
 
 

Action details: soul_cleave

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:30.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:soul_fragments=5
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
 
Simple Action Stats Execute Interval
Illistan
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
Consume Soul (_lesser) 64.3 6.16sec

Stats details: consume_soul_lesser

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 64.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: consume_soul_lesser

Static Values
  • id:203794
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:203794
  • name:Consume Soul
  • school:shadow
  • tooltip:
  • description:Consume a Lesser Soul Fragment, healing you for {$s1=0} health.
 
Demon Spikes 36.1 11.18sec

Stats details: demon_spikes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.08 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demon_spikes

Static Values
  • id:203720
  • school:physical
  • resource:pain
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
Spelldata
  • id:203720
  • name:Demon Spikes
  • school:physical
  • tooltip:
  • description:Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.
 
Empower Wards 11.3 36.89sec

Stats details: empower_wards

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: empower_wards

Static Values
  • id:218256
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.casting.up
Spelldata
  • id:218256
  • name:Empower Wards
  • school:fire
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
 
potion 1.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Soul Cleave (_heal) 44.3 8.99sec

Stats details: soul_cleave_heal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 44.34 0.00 131.64 0.00 0.0000 1.9971 0.00 0.00 0.00 0.00 0.00
 
 

Action details: soul_cleave_heal

Static Values
  • id:228477
  • school:physical
  • resource:pain
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Illistan
  • harmful:false
  • if_expr:
Spelldata
  • id:228477
  • name:Soul Cleave
  • school:physical
  • tooltip:
  • description:Viciously strike all enemies in front of you for up to $<cleaveDamage> Physical damage and heal yourself for up to $<cleaveHeal>, based on Pain spent. Consumes all Soul Fragments within {$s1=25} yds.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.300000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.2 8.7 28.4sec 17.2sec 45.13% 45.13% 8.7(8.7) 13.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 13.32% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Defensive Spikes 36.1 0.0 11.2sec 11.2sec 26.96% 25.70% 0.0(0.0) 35.8

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defensive_spikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.10

Stack Uptimes

  • defensive_spikes_1:26.96%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:212871
  • name:Defensive Spikes
  • tooltip:
  • description:{$@spelldesc212829=Increases your chance to parry by an additional {$212871s1=10}% for the first {$212871d=3 seconds} after activating Demon Spikes.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Demon Spikes 36.1 0.0 11.2sec 11.2sec 53.72% 53.53% 0.0(0.0) 35.6

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_demon_spikes
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • demon_spikes_1:53.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203819
  • name:Demon Spikes
  • tooltip:Parry chance increased by $w1%. Physical damage taken reduced by ${-$W2}.2%.
  • description:{$@spelldesc203720=Surge with fel power, increasing your Parry chance by {$203819s1=20}% and reducing Physical damage taken by {$203819s2=20}% for {$203819d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Empower Wards 11.3 0.0 36.9sec 36.9sec 16.77% 17.88% 0.0(0.0) 11.1

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_empower_wards
  • max_stacks:1
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
  • default_value:-0.30

Stack Uptimes

  • empower_wards_1:16.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218256
  • name:Empower Wards
  • tooltip:Magical damage taken reduced by {$s1=30}%.
  • description:Reduces magical damage taken by {$s1=30}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:20.00
  • default_chance:100.00%
Immolation Aura 29.1 0.0 13.9sec 13.9sec 43.37% 39.10% 173.4(173.4) 28.7

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_immolation_aura
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.30

Stack Uptimes

  • immolation_aura_1:43.37%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:178740
  • name:Immolation Aura
  • tooltip:Burns nearby enemies for {$178741s1=0} Fire damage every $178740t1 sec.$?a207548[ Movement speed increased by $w4%.][]
  • description:Engulf yourself in flames, instantly causing {$187727s1=0} Fire damage to enemies within $187727A1 yards and radiating {$178741s1=0} Fire damage every sec. Lasts {$d=6 seconds}. |cFFFFFFFFGenerates ${{$s3=80}/10+{$178741s2=20}/10*{$d=6 seconds}} Pain over {$d=6 seconds}.|r
  • max_stacks:0
  • duration:6.00
  • cooldown:15.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 9.76% 9.76% 2.0(2.0) 0.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:9.76%

Trigger Attempt Success

  • trigger_pct:100.00%
Unbending Potion 1.0 0.0 0.0sec 0.0sec 5.83% 5.83% 0.0(0.0) 1.0

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:5.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Illistan
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Illistan
demon_spikes Pain 36.1 721.6 20.0 20.0 0.0
soul_cleave Pain 44.3 2634.3 59.4 59.4 2834.8
Resource Gains Type Count Total Average Overflow
damage_taken Pain 255.40 460.68 (13.52%) 1.80 0.05 0.01%
immolation_aura Pain 29.15 233.17 (6.84%) 8.00 0.00 0.00%
immolation_aura_tick Pain 173.40 346.72 (10.17%) 2.00 0.08 0.02%
felblade_dmg Pain 40.23 804.62 (23.61%) 20.00 0.00 0.00%
shear Pain 156.35 1563.47 (45.87%) 10.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 61023.19 61445.27
Pain 8.51 8.38
Combat End Resource Mean Min Max
Pain 52.84 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %
Pain Cap 0.0%

Procs

Count Interval
parry_haste 32.1 12.2sec
soul_fragment_lesser 73.9 6.0sec
felblade_reset 25.1 15.8sec
soul_fragment_overflow 2.0 100.8sec

Statistics & Data Analysis

Fight Length
Sample Data Illistan Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Illistan Damage Per Second
Count 9999
Mean 205670.52
Minimum 179326.76
Maximum 242781.04
Spread ( max - min ) 63454.28
Range [ ( max - min ) / 2 * 100% ] 15.43%
Standard Deviation 10725.2516
5th Percentile 190116.42
95th Percentile 224547.25
( 95th Percentile - 5th Percentile ) 34430.84
Mean Distribution
Standard Deviation 107.2579
95.00% Confidence Intervall ( 205460.30 - 205880.74 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 104
0.1% Error 10446
0.1 Scale Factor Error with Delta=300 981970
0.05 Scale Factor Error with Delta=300 3927883
0.01 Scale Factor Error with Delta=300 98197096
Priority Target DPS
Sample Data Illistan Priority Target Damage Per Second
Count 9999
Mean 128921.91
Minimum 119590.18
Maximum 138459.11
Spread ( max - min ) 18868.93
Range [ ( max - min ) / 2 * 100% ] 7.32%
Standard Deviation 2340.2475
5th Percentile 125079.78
95th Percentile 132832.24
( 95th Percentile - 5th Percentile ) 7752.46
Mean Distribution
Standard Deviation 23.4036
95.00% Confidence Intervall ( 128876.04 - 128967.78 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 12
0.1% Error 1265
0.1 Scale Factor Error with Delta=300 46752
0.05 Scale Factor Error with Delta=300 187011
0.01 Scale Factor Error with Delta=300 4675276
DPS(e)
Sample Data Illistan Damage Per Second (Effective)
Count 9999
Mean 205670.52
Minimum 179326.76
Maximum 242781.04
Spread ( max - min ) 63454.28
Range [ ( max - min ) / 2 * 100% ] 15.43%
Damage
Sample Data Illistan Damage
Count 9999
Mean 81907217.29
Minimum 64187913.73
Maximum 96927350.50
Spread ( max - min ) 32739436.78
Range [ ( max - min ) / 2 * 100% ] 19.99%
DTPS
Sample Data Illistan Damage Taken Per Second
Count 9999
Mean 61419.97
Minimum 45573.23
Maximum 69482.75
Spread ( max - min ) 23909.51
Range [ ( max - min ) / 2 * 100% ] 19.46%
Standard Deviation 2106.3607
5th Percentile 58010.98
95th Percentile 64803.32
( 95th Percentile - 5th Percentile ) 6792.34
Mean Distribution
Standard Deviation 21.0647
95.00% Confidence Intervall ( 61378.69 - 61461.26 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 45
0.1% Error 4517
0.1 Scale Factor Error with Delta=300 37874
0.05 Scale Factor Error with Delta=300 151498
0.01 Scale Factor Error with Delta=300 3787469
HPS
Sample Data Illistan Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Illistan Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Illistan Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Illistan Healing Taken Per Second
Count 9999
Mean 60993.10
Minimum 45573.23
Maximum 68994.16
Spread ( max - min ) 23420.92
Range [ ( max - min ) / 2 * 100% ] 19.20%
TMI
Sample Data Illistan Theck-Meloree Index
Count 9999
Mean 61576.41
Minimum 59123.04
Maximum 64360.28
Spread ( max - min ) 5237.24
Range [ ( max - min ) / 2 * 100% ] 4.25%
Standard Deviation 624.1407
5th Percentile 60548.14
95th Percentile 62582.18
( 95th Percentile - 5th Percentile ) 2034.04
Mean Distribution
Standard Deviation 6.2417
95.00% Confidence Intervall ( 61564.18 - 61588.65 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 3
0.1% Error 394
0.1 Scale Factor Error with Delta=300 3325
0.05 Scale Factor Error with Delta=300 13301
0.01 Scale Factor Error with Delta=300 332543
ETMI
Sample Data IllistanTheck-Meloree Index (Effective)
Count 9999
Mean 63391.72
Minimum 62289.21
Maximum 64869.39
Spread ( max - min ) 2580.19
Range [ ( max - min ) / 2 * 100% ] 2.04%
Standard Deviation 337.3248
5th Percentile 62862.80
95th Percentile 63961.04
( 95th Percentile - 5th Percentile ) 1098.25
Mean Distribution
Standard Deviation 3.3734
95.00% Confidence Intervall ( 63385.11 - 63398.34 )
Normalized 95.00% Confidence Intervall ( 99.99% - 100.01% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 1
0.1% Error 108
0.1 Scale Factor Error with Delta=300 971
0.05 Scale Factor Error with Delta=300 3885
0.01 Scale Factor Error with Delta=300 97135
MSD
Sample Data Illistan Max Spike Value
Count 2499
Mean 20.66
Minimum 13.06
Maximum 29.73
Spread ( max - min ) 16.67
Range [ ( max - min ) / 2 * 100% ] 40.34%
Standard Deviation 2.6456
5th Percentile 16.72
95th Percentile 25.50
( 95th Percentile - 5th Percentile ) 8.78
Mean Distribution
Standard Deviation 0.0529
95.00% Confidence Intervall ( 20.56 - 20.76 )
Normalized 95.00% Confidence Intervall ( 99.50% - 100.50% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 629
0.1% Error 62986
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 5

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 33.64 auto_attack
6 7.32 fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
7 36.12 demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
8 11.25 empower_wards,if=debuff.casting.up
9 7.40 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
A 15.14 infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
0.00 spirit_bomb,if=debuff.frailty.down
B 7.06 soul_carver,if=dot.fiery_brand.ticking
C 29.27 immolation_aura,if=pain<=80
D 40.27 felblade,if=pain<=70
0.00 soul_barrier
E 6.97 soul_cleave,if=soul_fragments=5
0.00 metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
0.00 fel_devastation,if=incoming_damage_5s>health.max*0.70
0.00 soul_cleave,if=incoming_damage_5s>=health.max*0.70
0.00 fel_eruption
F 13.33 sigil_of_flame,if=remains-delay<=0.3*duration
0.00 fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
G 37.37 soul_cleave,if=pain>=80
H 156.35 shear

Sample Sequence

0124569B9C8D7FHDEHH7HHHC5HH7HHGDH7A5HHHCGHH75HDHHFGCH7DHH8AGHHD5HG7CH5HHHGDH75HCFH6BG9DEHD7HC85HHA5HH7HGHDHC5G7FHHHHAHHGC7DH5D5G8HDHC7HHG5DF6BHH9EC7HHHD5AGHH7HHCHHG8DH7HF5HHGACHDHG7H5HHHCHG7DHHHH69BF85ECHD7HHGHA5HH7H5CHHGDHHG7DHCF5HHGAD87HHHC5GH5HH7ADHGHH6B8CEFH5DH7HHHAA5HG7CHHD5HGHH7HHCHGDF5H7HAD8GC5HHHG7HA5HDHCG69BHEHFH7D5HCAH7HHHHGHD8H7C5HGDHHGH7DFCH5HAGHHH7HDGCHD5HG69BHH8EHC7FDHDA5H7HHGHH7CHHDGH

Sample Sequence Table

time name target resources buffs
Pre flask Illistan 0.0/100: 0% pain
Pre food Illistan 0.0/100: 0% pain
Pre augmentation Illistan 0.0/100: 0% pain
Pre potion Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 auto_attack Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 fiery_brand Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 infernal_strike Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:00.000 soul_carver Fluffy_Pillow 0.0/100: 0% pain unbending_potion
0:01.430 infernal_strike Fluffy_Pillow 0.0/100: 0% pain bloodlust, blood_frenzy, unbending_potion
0:01.430 immolation_aura Fluffy_Pillow 0.0/100: 0% pain bloodlust, blood_frenzy, unbending_potion
0:02.030 empower_wards Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:02.185 felblade Fluffy_Pillow 8.0/100: 8% pain bloodlust, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:02.185 demon_spikes Fluffy_Pillow 8.0/100: 8% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:03.206 sigil_of_flame Fluffy_Pillow 10.0/100: 10% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:03.959 shear Fluffy_Pillow 12.0/100: 12% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:04.979 felblade Fluffy_Pillow 24.0/100: 24% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:06.001 soul_cleave Fluffy_Pillow 47.3/100: 47% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:07.023 shear Fluffy_Pillow 3.5/100: 3% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy, unbending_potion
0:08.046 shear Fluffy_Pillow 17.2/100: 17% pain bloodlust, demon_spikes, blood_frenzy, unbending_potion
0:08.246 demon_spikes Fluffy_Pillow 7.2/100: 7% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:09.066 shear Fluffy_Pillow 8.1/100: 8% pain bloodlust, defensive_spikes, demon_spikes, blood_frenzy, unbending_potion
0:10.088 shear Fluffy_Pillow 18.1/100: 18% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:11.190 shear Fluffy_Pillow 29.1/100: 29% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:12.291 immolation_aura Fluffy_Pillow 39.1/100: 39% pain bloodlust, raid_movement, demon_spikes, unbending_potion
0:13.096 auto_attack Fluffy_Pillow 48.1/100: 48% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:13.096 shear Fluffy_Pillow 48.1/100: 48% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:14.197 shear Fluffy_Pillow 61.5/100: 62% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:14.297 demon_spikes Fluffy_Pillow 53.5/100: 54% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:15.297 shear Fluffy_Pillow 56.5/100: 56% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:16.399 shear Fluffy_Pillow 70.1/100: 70% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, unbending_potion
0:17.501 soul_cleave Fluffy_Pillow 83.0/100: 83% pain bloodlust, demon_spikes, immolation_aura, unbending_potion
0:18.603 felblade Fluffy_Pillow 26.7/100: 27% pain bloodlust, demon_spikes, unbending_potion
0:19.706 shear Fluffy_Pillow 47.7/100: 48% pain bloodlust, demon_spikes, unbending_potion
0:20.306 demon_spikes Fluffy_Pillow 39.3/100: 39% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, unbending_potion
0:20.807 infernal_strike Fluffy_Pillow 39.3/100: 39% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, unbending_potion
0:20.807 auto_attack Fluffy_Pillow 39.3/100: 39% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:20.807 shear Fluffy_Pillow 39.3/100: 39% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:21.909 shear Fluffy_Pillow 50.3/100: 50% pain bloodlust, defensive_spikes, demon_spikes, unbending_potion
0:23.009 shear Fluffy_Pillow 62.8/100: 63% pain bloodlust, defensive_spikes, demon_spikes
0:24.108 immolation_aura Fluffy_Pillow 72.8/100: 73% pain bloodlust, demon_spikes
0:24.915 soul_cleave Fluffy_Pillow 80.8/100: 81% pain bloodlust, demon_spikes, immolation_aura
0:26.016 shear Fluffy_Pillow 25.0/100: 25% pain bloodlust, demon_spikes, immolation_aura
0:27.117 shear Fluffy_Pillow 39.0/100: 39% pain bloodlust, immolation_aura
0:27.491 demon_spikes Fluffy_Pillow 29.0/100: 29% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:28.218 Waiting 0.700 sec 33.2/100: 33% pain bloodlust, raid_movement, defensive_spikes, demon_spikes, immolation_aura
0:28.918 auto_attack Fluffy_Pillow 33.2/100: 33% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:28.918 shear Fluffy_Pillow 33.2/100: 33% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:30.020 felblade Fluffy_Pillow 45.2/100: 45% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura
0:31.121 shear Fluffy_Pillow 67.2/100: 67% pain bloodlust, demon_spikes
0:32.221 shear Fluffy_Pillow 77.2/100: 77% pain bloodlust, demon_spikes
0:33.324 sigil_of_flame Fluffy_Pillow 87.2/100: 87% pain bloodlust, demon_spikes
0:34.132 soul_cleave Fluffy_Pillow 90.4/100: 90% pain bloodlust
0:35.232 immolation_aura Fluffy_Pillow 30.4/100: 30% pain bloodlust, blood_frenzy
0:35.988 shear Fluffy_Pillow 38.4/100: 38% pain bloodlust, immolation_aura, blood_frenzy
0:37.007 demon_spikes Fluffy_Pillow 57.1/100: 57% pain bloodlust, immolation_aura, blood_frenzy
0:37.146 felblade Fluffy_Pillow 37.1/100: 37% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:38.166 shear Fluffy_Pillow 59.1/100: 59% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:39.186 shear Fluffy_Pillow 71.1/100: 71% pain bloodlust, defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
0:40.086 empower_wards Fluffy_Pillow 85.0/100: 85% pain bloodlust, defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:40.207 infernal_strike Fluffy_Pillow 85.0/100: 85% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:40.207 soul_cleave Fluffy_Pillow 85.0/100: 85% pain bloodlust, demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:41.228 shear Fluffy_Pillow 27.0/100: 27% pain demon_spikes, empower_wards, immolation_aura, blood_frenzy
0:42.553 shear Fluffy_Pillow 42.8/100: 43% pain demon_spikes, empower_wards, blood_frenzy
0:43.881 felblade Fluffy_Pillow 52.8/100: 53% pain empower_wards, blood_frenzy
0:45.207 auto_attack Fluffy_Pillow 76.0/100: 76% pain empower_wards
0:45.207 shear Fluffy_Pillow 76.0/100: 76% pain empower_wards
0:46.638 soul_cleave Fluffy_Pillow 89.9/100: 90% pain
0:47.166 demon_spikes Fluffy_Pillow 9.9/100: 10% pain defensive_spikes, demon_spikes
0:48.070 immolation_aura Fluffy_Pillow 12.9/100: 13% pain defensive_spikes, demon_spikes
0:49.433 shear Fluffy_Pillow 22.9/100: 23% pain defensive_spikes, demon_spikes, immolation_aura
0:50.863 Waiting 1.900 sec 37.8/100: 38% pain raid_movement, demon_spikes, immolation_aura
0:52.763 auto_attack Fluffy_Pillow 42.8/100: 43% pain demon_spikes, immolation_aura, blood_frenzy
0:52.763 shear Fluffy_Pillow 42.8/100: 43% pain demon_spikes, immolation_aura, blood_frenzy
0:54.088 shear Fluffy_Pillow 60.9/100: 61% pain blood_frenzy
0:55.413 shear Fluffy_Pillow 70.9/100: 71% pain blood_frenzy
0:56.739 soul_cleave Fluffy_Pillow 84.7/100: 85% pain blood_frenzy
0:58.065 felblade Fluffy_Pillow 29.0/100: 29% pain blood_frenzy
0:59.391 shear Fluffy_Pillow 49.0/100: 49% pain blood_frenzy
0:59.668 demon_spikes Fluffy_Pillow 39.0/100: 39% pain defensive_spikes, demon_spikes, blood_frenzy
1:00.717 Waiting 0.500 sec 42.2/100: 42% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
1:01.217 auto_attack Fluffy_Pillow 42.2/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
1:01.217 shear Fluffy_Pillow 42.2/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
1:02.543 immolation_aura Fluffy_Pillow 53.2/100: 53% pain defensive_spikes, demon_spikes, blood_frenzy
1:03.712 sigil_of_flame Fluffy_Pillow 63.2/100: 63% pain demon_spikes, immolation_aura, blood_frenzy
1:04.879 shear Fluffy_Pillow 66.2/100: 66% pain demon_spikes, immolation_aura, blood_frenzy
1:05.679 fiery_brand Fluffy_Pillow 80.8/100: 81% pain immolation_aura
1:06.205 soul_carver Fluffy_Pillow 82.6/100: 83% pain immolation_aura
1:07.636 soul_cleave Fluffy_Pillow 86.6/100: 87% pain immolation_aura
1:09.067 infernal_strike Fluffy_Pillow 30.5/100: 31% pain
1:09.067 felblade Fluffy_Pillow 30.5/100: 31% pain
1:10.499 soul_cleave Fluffy_Pillow 52.5/100: 53% pain
1:11.930 shear Fluffy_Pillow 0.0/100: 0% pain
1:13.361 felblade Fluffy_Pillow 11.9/100: 12% pain
1:13.761 demon_spikes Fluffy_Pillow 11.9/100: 12% pain defensive_spikes, demon_spikes
1:14.792 shear Fluffy_Pillow 13.9/100: 14% pain defensive_spikes, demon_spikes
1:16.223 Waiting 0.200 sec 23.9/100: 24% pain raid_movement, defensive_spikes, demon_spikes
1:16.423 immolation_aura Fluffy_Pillow 23.9/100: 24% pain raid_movement, defensive_spikes, demon_spikes
1:17.085 empower_wards Fluffy_Pillow 31.9/100: 32% pain demon_spikes, empower_wards, immolation_aura
1:17.948 auto_attack Fluffy_Pillow 33.9/100: 34% pain demon_spikes, empower_wards, immolation_aura
1:17.948 shear Fluffy_Pillow 33.9/100: 34% pain demon_spikes, empower_wards, immolation_aura
1:19.379 shear Fluffy_Pillow 49.6/100: 50% pain demon_spikes, empower_wards, immolation_aura
1:20.808 infernal_strike Fluffy_Pillow 66.7/100: 67% pain raid_movement, empower_wards, immolation_aura
1:20.808 auto_attack Fluffy_Pillow 66.7/100: 67% pain empower_wards, immolation_aura
1:20.808 shear Fluffy_Pillow 66.7/100: 67% pain empower_wards, immolation_aura
1:22.241 shear Fluffy_Pillow 78.7/100: 79% pain empower_wards, immolation_aura
1:22.753 demon_spikes Fluffy_Pillow 70.7/100: 71% pain defensive_spikes, demon_spikes, empower_wards
1:23.672 shear Fluffy_Pillow 70.7/100: 71% pain defensive_spikes, demon_spikes
1:25.103 soul_cleave Fluffy_Pillow 82.5/100: 83% pain defensive_spikes, demon_spikes
1:26.535 shear Fluffy_Pillow 22.5/100: 23% pain demon_spikes
1:27.967 felblade Fluffy_Pillow 33.5/100: 33% pain demon_spikes
1:29.399 shear Fluffy_Pillow 56.5/100: 56% pain
1:30.829 immolation_aura Fluffy_Pillow 69.6/100: 70% pain
1:32.191 Waiting 0.700 sec 80.6/100: 81% pain raid_movement, immolation_aura, blood_frenzy
1:32.891 auto_attack Fluffy_Pillow 82.6/100: 83% pain immolation_aura, blood_frenzy
1:32.891 soul_cleave Fluffy_Pillow 82.6/100: 83% pain immolation_aura, blood_frenzy
1:33.789 demon_spikes Fluffy_Pillow 3.6/100: 4% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:34.216 sigil_of_flame Fluffy_Pillow 10.1/100: 10% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:35.383 shear Fluffy_Pillow 13.1/100: 13% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:36.710 shear Fluffy_Pillow 27.3/100: 27% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
1:38.035 shear Fluffy_Pillow 40.2/100: 40% pain demon_spikes, blood_frenzy
1:39.361 shear Fluffy_Pillow 51.2/100: 51% pain demon_spikes, blood_frenzy
1:40.687 infernal_strike Fluffy_Pillow 64.3/100: 64% pain blood_frenzy
1:40.687 shear Fluffy_Pillow 64.3/100: 64% pain blood_frenzy
1:42.013 shear Fluffy_Pillow 78.2/100: 78% pain
1:43.447 soul_cleave Fluffy_Pillow 89.2/100: 89% pain
1:44.878 immolation_aura Fluffy_Pillow 29.2/100: 29% pain
1:46.239 demon_spikes Fluffy_Pillow 43.3/100: 43% pain immolation_aura
1:46.414 felblade Fluffy_Pillow 23.3/100: 23% pain defensive_spikes, demon_spikes, immolation_aura
1:47.846 shear Fluffy_Pillow 45.3/100: 45% pain defensive_spikes, demon_spikes, immolation_aura
1:49.278 auto_attack Fluffy_Pillow 61.1/100: 61% pain defensive_spikes, demon_spikes, immolation_aura
1:49.278 felblade Fluffy_Pillow 61.1/100: 61% pain defensive_spikes, demon_spikes, immolation_aura
1:50.711 Waiting 2.700 sec 83.1/100: 83% pain raid_movement, demon_spikes, immolation_aura
1:53.411 auto_attack Fluffy_Pillow 87.1/100: 87% pain
1:53.411 soul_cleave Fluffy_Pillow 87.1/100: 87% pain
1:54.111 empower_wards Fluffy_Pillow 30.0/100: 30% pain empower_wards
1:54.844 shear Fluffy_Pillow 30.0/100: 30% pain empower_wards
1:56.274 felblade Fluffy_Pillow 44.4/100: 44% pain empower_wards
1:57.707 shear Fluffy_Pillow 64.4/100: 64% pain empower_wards
1:59.140 immolation_aura Fluffy_Pillow 74.4/100: 74% pain empower_wards
2:00.512 demon_spikes Fluffy_Pillow 87.5/100: 88% pain immolation_aura
2:00.688 shear Fluffy_Pillow 67.5/100: 68% pain defensive_spikes, demon_spikes, immolation_aura
2:02.118 shear Fluffy_Pillow 79.5/100: 80% pain defensive_spikes, demon_spikes, immolation_aura
2:03.548 soul_cleave Fluffy_Pillow 95.8/100: 96% pain defensive_spikes, demon_spikes, immolation_aura
2:04.980 auto_attack Fluffy_Pillow 39.8/100: 40% pain demon_spikes, immolation_aura
2:04.980 felblade Fluffy_Pillow 39.8/100: 40% pain demon_spikes, immolation_aura
2:06.411 sigil_of_flame Fluffy_Pillow 61.8/100: 62% pain demon_spikes
2:06.711 fiery_brand Fluffy_Pillow 61.8/100: 62% pain
2:07.773 soul_carver Fluffy_Pillow 61.8/100: 62% pain
2:09.204 shear Fluffy_Pillow 62.4/100: 62% pain
2:10.635 shear Fluffy_Pillow 74.9/100: 75% pain
2:12.066 infernal_strike Fluffy_Pillow 87.5/100: 87% pain
2:12.066 soul_cleave Fluffy_Pillow 87.5/100: 87% pain
2:13.497 immolation_aura Fluffy_Pillow 27.5/100: 27% pain
2:14.797 demon_spikes Fluffy_Pillow 19.8/100: 20% pain defensive_spikes, demon_spikes, immolation_aura
2:14.859 shear Fluffy_Pillow 19.8/100: 20% pain defensive_spikes, demon_spikes, immolation_aura
2:16.291 shear Fluffy_Pillow 32.8/100: 33% pain defensive_spikes, demon_spikes, immolation_aura
2:17.723 shear Fluffy_Pillow 46.8/100: 47% pain defensive_spikes, demon_spikes, immolation_aura
2:19.157 felblade Fluffy_Pillow 61.8/100: 62% pain demon_spikes, immolation_aura
2:20.686 auto_attack Fluffy_Pillow 84.7/100: 85% pain demon_spikes, blood_frenzy
2:20.686 infernal_strike Fluffy_Pillow 84.7/100: 85% pain demon_spikes, blood_frenzy
2:20.686 soul_cleave Fluffy_Pillow 84.7/100: 85% pain demon_spikes, blood_frenzy
2:22.011 shear Fluffy_Pillow 27.8/100: 28% pain blood_frenzy
2:23.335 shear Fluffy_Pillow 38.8/100: 39% pain blood_frenzy
2:23.788 demon_spikes Fluffy_Pillow 28.8/100: 29% pain defensive_spikes, demon_spikes, blood_frenzy
2:24.661 shear Fluffy_Pillow 29.7/100: 30% pain defensive_spikes, demon_spikes, blood_frenzy
2:25.986 shear Fluffy_Pillow 39.7/100: 40% pain defensive_spikes, demon_spikes, blood_frenzy
2:27.308 immolation_aura Fluffy_Pillow 50.7/100: 51% pain demon_spikes, blood_frenzy
2:28.475 shear Fluffy_Pillow 60.7/100: 61% pain demon_spikes, immolation_aura, blood_frenzy
2:29.799 shear Fluffy_Pillow 72.7/100: 73% pain immolation_aura
2:31.230 soul_cleave Fluffy_Pillow 87.5/100: 88% pain immolation_aura
2:32.130 empower_wards Fluffy_Pillow 36.1/100: 36% pain empower_wards, immolation_aura
2:32.661 felblade Fluffy_Pillow 38.1/100: 38% pain empower_wards, immolation_aura
2:34.151 shear Fluffy_Pillow 65.1/100: 65% pain empower_wards
2:35.584 demon_spikes Fluffy_Pillow 75.1/100: 75% pain empower_wards
2:35.622 shear Fluffy_Pillow 55.1/100: 55% pain defensive_spikes, demon_spikes, empower_wards
2:37.055 sigil_of_flame Fluffy_Pillow 65.1/100: 65% pain raid_movement, defensive_spikes, demon_spikes, empower_wards
2:38.418 auto_attack Fluffy_Pillow 65.1/100: 65% pain defensive_spikes, demon_spikes
2:38.418 shear Fluffy_Pillow 65.1/100: 65% pain defensive_spikes, demon_spikes
2:39.850 shear Fluffy_Pillow 75.1/100: 75% pain demon_spikes
2:41.280 soul_cleave Fluffy_Pillow 87.2/100: 87% pain demon_spikes, blood_frenzy
2:42.604 infernal_strike Fluffy_Pillow 30.1/100: 30% pain blood_frenzy
2:42.604 immolation_aura Fluffy_Pillow 30.1/100: 30% pain blood_frenzy
2:43.771 shear Fluffy_Pillow 40.1/100: 40% pain immolation_aura, blood_frenzy
2:45.096 felblade Fluffy_Pillow 52.1/100: 52% pain immolation_aura, blood_frenzy
2:46.423 shear Fluffy_Pillow 76.9/100: 77% pain immolation_aura, blood_frenzy
2:47.749 soul_cleave Fluffy_Pillow 90.9/100: 91% pain immolation_aura, blood_frenzy
2:47.749 demon_spikes Fluffy_Pillow 10.9/100: 11% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
2:49.075 shear Fluffy_Pillow 13.9/100: 14% pain defensive_spikes, demon_spikes, blood_frenzy
2:50.401 Waiting 2.200 sec 23.9/100: 24% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
2:52.601 auto_attack Fluffy_Pillow 27.1/100: 27% pain demon_spikes
2:52.601 shear Fluffy_Pillow 27.1/100: 27% pain demon_spikes
2:54.034 shear Fluffy_Pillow 41.2/100: 41% pain
2:55.465 shear Fluffy_Pillow 52.2/100: 52% pain blood_frenzy
2:56.791 immolation_aura Fluffy_Pillow 65.3/100: 65% pain blood_frenzy
2:57.958 shear Fluffy_Pillow 76.3/100: 76% pain immolation_aura, blood_frenzy
2:59.284 soul_cleave Fluffy_Pillow 89.3/100: 89% pain immolation_aura, blood_frenzy
2:59.641 demon_spikes Fluffy_Pillow 9.3/100: 9% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:00.608 felblade Fluffy_Pillow 13.3/100: 13% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:01.934 shear Fluffy_Pillow 40.7/100: 41% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:03.260 shear Fluffy_Pillow 53.7/100: 54% pain demon_spikes, blood_frenzy
3:04.584 shear Fluffy_Pillow 65.6/100: 66% pain demon_spikes
3:06.015 shear Fluffy_Pillow 79.6/100: 80% pain
3:06.711 fiery_brand Fluffy_Pillow 89.6/100: 90% pain
3:07.446 infernal_strike Fluffy_Pillow 90.2/100: 90% pain
3:07.446 soul_carver Fluffy_Pillow 90.2/100: 90% pain
3:08.878 sigil_of_flame Fluffy_Pillow 92.2/100: 92% pain raid_movement
3:09.178 empower_wards Fluffy_Pillow 92.2/100: 92% pain empower_wards
3:10.240 auto_attack Fluffy_Pillow 94.0/100: 94% pain empower_wards
3:10.240 soul_cleave Fluffy_Pillow 94.0/100: 94% pain empower_wards
3:11.673 immolation_aura Fluffy_Pillow 34.8/100: 35% pain empower_wards, blood_frenzy
3:12.841 shear Fluffy_Pillow 46.7/100: 47% pain empower_wards, immolation_aura, blood_frenzy
3:14.167 felblade Fluffy_Pillow 60.4/100: 60% pain empower_wards, immolation_aura, blood_frenzy
3:14.727 demon_spikes Fluffy_Pillow 62.4/100: 62% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
3:15.653 shear Fluffy_Pillow 62.4/100: 62% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:16.977 shear Fluffy_Pillow 76.4/100: 76% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
3:18.303 soul_cleave Fluffy_Pillow 88.4/100: 88% pain demon_spikes, blood_frenzy
3:19.629 shear Fluffy_Pillow 28.4/100: 28% pain demon_spikes, blood_frenzy
3:20.955 infernal_strike Fluffy_Pillow 38.4/100: 38% pain raid_movement
3:20.955 auto_attack Fluffy_Pillow 38.4/100: 38% pain
3:20.955 shear Fluffy_Pillow 38.4/100: 38% pain
3:22.387 shear Fluffy_Pillow 51.6/100: 52% pain
3:22.991 demon_spikes Fluffy_Pillow 41.6/100: 42% pain defensive_spikes, demon_spikes
3:23.819 shear Fluffy_Pillow 41.6/100: 42% pain defensive_spikes, demon_spikes
3:25.250 auto_attack Fluffy_Pillow 53.5/100: 53% pain defensive_spikes, demon_spikes
3:25.250 immolation_aura Fluffy_Pillow 53.5/100: 53% pain defensive_spikes, demon_spikes
3:26.585 shear Fluffy_Pillow 63.5/100: 63% pain demon_spikes, immolation_aura, blood_frenzy
3:27.911 shear Fluffy_Pillow 75.5/100: 75% pain demon_spikes, immolation_aura, blood_frenzy
3:29.237 soul_cleave Fluffy_Pillow 89.5/100: 90% pain immolation_aura, blood_frenzy
3:30.563 felblade Fluffy_Pillow 41.1/100: 41% pain immolation_aura, blood_frenzy
3:31.889 shear Fluffy_Pillow 63.1/100: 63% pain blood_frenzy
3:33.214 shear Fluffy_Pillow 77.1/100: 77% pain blood_frenzy
3:34.541 soul_cleave Fluffy_Pillow 91.4/100: 91% pain blood_frenzy
3:34.541 demon_spikes Fluffy_Pillow 11.4/100: 11% pain defensive_spikes, demon_spikes, blood_frenzy
3:35.867 felblade Fluffy_Pillow 11.4/100: 11% pain defensive_spikes, demon_spikes, blood_frenzy
3:37.193 shear Fluffy_Pillow 34.2/100: 34% pain defensive_spikes, demon_spikes
3:38.624 immolation_aura Fluffy_Pillow 47.4/100: 47% pain demon_spikes
3:40.054 sigil_of_flame Fluffy_Pillow 57.4/100: 57% pain raid_movement, demon_spikes, immolation_aura
3:41.417 auto_attack Fluffy_Pillow 60.3/100: 60% pain immolation_aura
3:41.417 shear Fluffy_Pillow 60.3/100: 60% pain immolation_aura
3:42.849 shear Fluffy_Pillow 78.6/100: 79% pain immolation_aura
3:44.280 soul_cleave Fluffy_Pillow 94.4/100: 94% pain immolation_aura, blood_frenzy
3:45.605 infernal_strike Fluffy_Pillow 36.4/100: 36% pain blood_frenzy
3:45.605 felblade Fluffy_Pillow 36.4/100: 36% pain blood_frenzy
3:46.105 empower_wards Fluffy_Pillow 60.2/100: 60% pain empower_wards, blood_frenzy
3:46.931 demon_spikes Fluffy_Pillow 60.2/100: 60% pain empower_wards, blood_frenzy
3:47.122 shear Fluffy_Pillow 40.2/100: 40% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:48.447 shear Fluffy_Pillow 52.3/100: 52% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:49.774 shear Fluffy_Pillow 62.3/100: 62% pain defensive_spikes, demon_spikes, empower_wards, blood_frenzy
3:51.100 Waiting 0.900 sec 74.2/100: 74% pain raid_movement, demon_spikes, empower_wards, blood_frenzy
3:52.000 immolation_aura Fluffy_Pillow 74.2/100: 74% pain raid_movement, demon_spikes, empower_wards, blood_frenzy
3:53.421 auto_attack Fluffy_Pillow 84.2/100: 84% pain immolation_aura
3:53.421 soul_cleave Fluffy_Pillow 84.2/100: 84% pain immolation_aura
3:54.852 shear Fluffy_Pillow 26.2/100: 26% pain immolation_aura
3:56.282 Waiting 0.600 sec 43.5/100: 43% pain raid_movement, immolation_aura
3:56.882 auto_attack Fluffy_Pillow 43.5/100: 43% pain immolation_aura
3:56.882 shear Fluffy_Pillow 43.5/100: 43% pain immolation_aura
3:58.313 shear Fluffy_Pillow 60.3/100: 60% pain
3:59.744 demon_spikes Fluffy_Pillow 73.6/100: 74% pain
3:59.935 infernal_strike Fluffy_Pillow 53.6/100: 54% pain defensive_spikes, demon_spikes
4:00.001 felblade Fluffy_Pillow 53.6/100: 54% pain defensive_spikes, demon_spikes
4:01.433 shear Fluffy_Pillow 73.6/100: 74% pain defensive_spikes, demon_spikes
4:02.864 soul_cleave Fluffy_Pillow 85.4/100: 85% pain defensive_spikes, demon_spikes, blood_frenzy
4:04.189 shear Fluffy_Pillow 27.3/100: 27% pain demon_spikes, blood_frenzy
4:05.515 shear Fluffy_Pillow 37.3/100: 37% pain demon_spikes, blood_frenzy
4:06.711 fiery_brand Fluffy_Pillow 50.4/100: 50% pain blood_frenzy
4:06.840 soul_carver Fluffy_Pillow 50.4/100: 50% pain blood_frenzy
4:08.140 empower_wards Fluffy_Pillow 52.3/100: 52% pain empower_wards, blood_frenzy
4:08.166 immolation_aura Fluffy_Pillow 52.3/100: 52% pain empower_wards, blood_frenzy
4:09.334 soul_cleave Fluffy_Pillow 62.3/100: 62% pain empower_wards, immolation_aura, blood_frenzy
4:10.662 sigil_of_flame Fluffy_Pillow 6.0/100: 6% pain empower_wards, immolation_aura, blood_frenzy
4:11.829 shear Fluffy_Pillow 8.4/100: 8% pain empower_wards, immolation_aura, blood_frenzy
4:13.154 auto_attack Fluffy_Pillow 20.8/100: 21% pain empower_wards, immolation_aura, blood_frenzy
4:13.154 felblade Fluffy_Pillow 20.8/100: 21% pain empower_wards, immolation_aura, blood_frenzy
4:14.479 shear Fluffy_Pillow 46.5/100: 47% pain blood_frenzy
4:14.779 demon_spikes Fluffy_Pillow 36.5/100: 37% pain defensive_spikes, demon_spikes, blood_frenzy
4:15.806 shear Fluffy_Pillow 37.5/100: 37% pain defensive_spikes, demon_spikes, blood_frenzy
4:17.131 shear Fluffy_Pillow 48.5/100: 48% pain defensive_spikes, demon_spikes, blood_frenzy
4:18.458 shear Fluffy_Pillow 58.5/100: 58% pain demon_spikes, blood_frenzy
4:19.782 infernal_strike Fluffy_Pillow 69.4/100: 69% pain demon_spikes, blood_frenzy
4:20.000 infernal_strike Fluffy_Pillow 69.4/100: 69% pain raid_movement, demon_spikes, blood_frenzy
4:20.000 auto_attack Fluffy_Pillow 69.4/100: 69% pain demon_spikes, blood_frenzy
4:20.000 shear Fluffy_Pillow 69.4/100: 69% pain demon_spikes, blood_frenzy
4:21.326 soul_cleave Fluffy_Pillow 80.4/100: 80% pain blood_frenzy
4:21.326 demon_spikes Fluffy_Pillow 0.4/100: 0% pain defensive_spikes, demon_spikes, blood_frenzy
4:22.651 immolation_aura Fluffy_Pillow 2.6/100: 3% pain defensive_spikes, demon_spikes, blood_frenzy
4:23.911 shear Fluffy_Pillow 13.5/100: 14% pain defensive_spikes, demon_spikes, immolation_aura
4:25.342 shear Fluffy_Pillow 30.7/100: 31% pain demon_spikes, immolation_aura
4:26.773 felblade Fluffy_Pillow 46.6/100: 47% pain demon_spikes, immolation_aura
4:28.203 Waiting 0.800 sec 76.1/100: 76% pain raid_movement, immolation_aura
4:29.003 auto_attack Fluffy_Pillow 78.1/100: 78% pain
4:29.003 shear Fluffy_Pillow 78.1/100: 78% pain
4:30.433 soul_cleave Fluffy_Pillow 92.3/100: 92% pain
4:31.866 shear Fluffy_Pillow 32.3/100: 32% pain
4:33.297 shear Fluffy_Pillow 45.4/100: 45% pain
4:33.567 demon_spikes Fluffy_Pillow 35.4/100: 35% pain defensive_spikes, demon_spikes
4:34.730 shear Fluffy_Pillow 37.3/100: 37% pain defensive_spikes, demon_spikes
4:36.162 shear Fluffy_Pillow 49.2/100: 49% pain defensive_spikes, demon_spikes
4:37.595 immolation_aura Fluffy_Pillow 59.2/100: 59% pain demon_spikes
4:38.956 shear Fluffy_Pillow 71.4/100: 71% pain demon_spikes, immolation_aura
4:40.386 soul_cleave Fluffy_Pillow 86.8/100: 87% pain immolation_aura
4:41.817 felblade Fluffy_Pillow 30.8/100: 31% pain immolation_aura
4:43.249 sigil_of_flame Fluffy_Pillow 52.8/100: 53% pain immolation_aura
4:44.611 Waiting 0.600 sec 58.1/100: 58% pain raid_movement
4:45.211 auto_attack Fluffy_Pillow 58.1/100: 58% pain
4:45.211 shear Fluffy_Pillow 58.1/100: 58% pain
4:46.642 demon_spikes Fluffy_Pillow 71.1/100: 71% pain
4:46.841 shear Fluffy_Pillow 51.1/100: 51% pain defensive_spikes, demon_spikes
4:48.273 infernal_strike Fluffy_Pillow 61.1/100: 61% pain defensive_spikes, demon_spikes
4:48.273 felblade Fluffy_Pillow 61.1/100: 61% pain defensive_spikes, demon_spikes
4:49.173 empower_wards Fluffy_Pillow 81.1/100: 81% pain defensive_spikes, demon_spikes, empower_wards
4:49.703 soul_cleave Fluffy_Pillow 81.1/100: 81% pain defensive_spikes, demon_spikes, empower_wards
4:51.134 Waiting 0.500 sec 21.1/100: 21% pain raid_movement, demon_spikes, empower_wards
4:51.634 immolation_aura Fluffy_Pillow 21.1/100: 21% pain raid_movement, demon_spikes, empower_wards
4:53.127 Waiting 0.100 sec 33.9/100: 34% pain raid_movement, empower_wards, immolation_aura, blood_frenzy
4:53.227 auto_attack Fluffy_Pillow 33.9/100: 34% pain empower_wards, immolation_aura, blood_frenzy
4:53.227 shear Fluffy_Pillow 33.9/100: 34% pain empower_wards, immolation_aura, blood_frenzy
4:54.552 shear Fluffy_Pillow 49.7/100: 50% pain empower_wards, immolation_aura, blood_frenzy
4:55.878 shear Fluffy_Pillow 63.7/100: 64% pain immolation_aura, blood_frenzy
4:57.201 soul_cleave Fluffy_Pillow 83.5/100: 84% pain immolation_aura, blood_frenzy
4:58.500 demon_spikes Fluffy_Pillow 9.6/100: 10% pain defensive_spikes, demon_spikes, blood_frenzy
4:58.526 shear Fluffy_Pillow 9.6/100: 10% pain defensive_spikes, demon_spikes, blood_frenzy
4:59.851 infernal_strike Fluffy_Pillow 19.6/100: 20% pain defensive_spikes, demon_spikes, blood_frenzy
5:00.000 Waiting 1.200 sec 21.7/100: 22% pain raid_movement, defensive_spikes, demon_spikes, blood_frenzy
5:01.200 auto_attack Fluffy_Pillow 22.6/100: 23% pain defensive_spikes, demon_spikes, blood_frenzy
5:01.200 shear Fluffy_Pillow 22.6/100: 23% pain defensive_spikes, demon_spikes, blood_frenzy
5:02.526 felblade Fluffy_Pillow 37.5/100: 38% pain demon_spikes, blood_frenzy
5:03.850 shear Fluffy_Pillow 57.5/100: 58% pain demon_spikes, blood_frenzy
5:05.175 immolation_aura Fluffy_Pillow 70.7/100: 71% pain blood_frenzy
5:06.342 soul_cleave Fluffy_Pillow 84.7/100: 85% pain immolation_aura, blood_frenzy
5:06.711 fiery_brand Fluffy_Pillow 24.7/100: 25% pain immolation_aura, blood_frenzy
5:07.668 infernal_strike Fluffy_Pillow 26.7/100: 27% pain immolation_aura, blood_frenzy
5:07.668 soul_carver Fluffy_Pillow 26.7/100: 27% pain immolation_aura, blood_frenzy
5:08.993 shear Fluffy_Pillow 31.3/100: 31% pain immolation_aura
5:10.424 soul_cleave Fluffy_Pillow 47.6/100: 48% pain immolation_aura
5:11.857 shear Fluffy_Pillow 2.0/100: 2% pain
5:13.289 sigil_of_flame Fluffy_Pillow 12.0/100: 12% pain
5:14.649 shear Fluffy_Pillow 14.0/100: 14% pain
5:14.749 demon_spikes Fluffy_Pillow 4.0/100: 4% pain defensive_spikes, demon_spikes
5:16.080 felblade Fluffy_Pillow 5.9/100: 6% pain raid_movement, defensive_spikes, demon_spikes
5:17.747 auto_attack Fluffy_Pillow 25.9/100: 26% pain defensive_spikes, demon_spikes
5:17.747 shear Fluffy_Pillow 25.9/100: 26% pain defensive_spikes, demon_spikes
5:19.179 immolation_aura Fluffy_Pillow 35.9/100: 36% pain demon_spikes
5:20.539 infernal_strike Fluffy_Pillow 48.1/100: 48% pain demon_spikes, immolation_aura
5:20.539 shear Fluffy_Pillow 48.1/100: 48% pain demon_spikes, immolation_aura
5:21.081 demon_spikes Fluffy_Pillow 38.1/100: 38% pain defensive_spikes, demon_spikes, immolation_aura
5:21.968 shear Fluffy_Pillow 40.1/100: 40% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:23.293 shear Fluffy_Pillow 54.1/100: 54% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
5:24.618 shear Fluffy_Pillow 66.1/100: 66% pain demon_spikes, immolation_aura, blood_frenzy
5:25.943 shear Fluffy_Pillow 78.1/100: 78% pain demon_spikes, blood_frenzy
5:27.268 soul_cleave Fluffy_Pillow 92.7/100: 93% pain blood_frenzy
5:28.594 shear Fluffy_Pillow 35.8/100: 36% pain blood_frenzy
5:29.919 felblade Fluffy_Pillow 45.8/100: 46% pain blood_frenzy
5:30.219 empower_wards Fluffy_Pillow 69.1/100: 69% pain empower_wards, blood_frenzy
5:31.243 shear Fluffy_Pillow 69.1/100: 69% pain empower_wards, blood_frenzy
5:32.389 demon_spikes Fluffy_Pillow 62.3/100: 62% pain raid_movement, defensive_spikes, demon_spikes, empower_wards
5:32.569 immolation_aura Fluffy_Pillow 62.3/100: 62% pain raid_movement, defensive_spikes, demon_spikes, empower_wards
5:34.009 auto_attack Fluffy_Pillow 75.1/100: 75% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
5:34.009 shear Fluffy_Pillow 75.1/100: 75% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura
5:35.441 soul_cleave Fluffy_Pillow 87.8/100: 88% pain demon_spikes, empower_wards, immolation_aura
5:36.873 felblade Fluffy_Pillow 31.8/100: 32% pain demon_spikes, immolation_aura
5:38.304 shear Fluffy_Pillow 56.8/100: 57% pain demon_spikes, immolation_aura, blood_frenzy
5:39.630 shear Fluffy_Pillow 71.9/100: 72% pain blood_frenzy
5:40.955 soul_cleave Fluffy_Pillow 84.7/100: 85% pain blood_frenzy
5:42.282 shear Fluffy_Pillow 28.7/100: 29% pain blood_frenzy
5:43.140 demon_spikes Fluffy_Pillow 19.7/100: 20% pain defensive_spikes, demon_spikes, blood_frenzy
5:43.607 felblade Fluffy_Pillow 19.7/100: 20% pain defensive_spikes, demon_spikes, blood_frenzy
5:44.934 sigil_of_flame Fluffy_Pillow 41.6/100: 42% pain defensive_spikes, demon_spikes, blood_frenzy
5:46.103 immolation_aura Fluffy_Pillow 42.6/100: 43% pain defensive_spikes, demon_spikes, blood_frenzy
5:47.399 shear Fluffy_Pillow 53.6/100: 54% pain demon_spikes, immolation_aura, blood_frenzy
5:48.725 Waiting 0.200 sec 65.6/100: 66% pain raid_movement, demon_spikes, immolation_aura, blood_frenzy
5:48.925 auto_attack Fluffy_Pillow 65.6/100: 66% pain demon_spikes, immolation_aura, blood_frenzy
5:48.925 shear Fluffy_Pillow 65.6/100: 66% pain demon_spikes, immolation_aura, blood_frenzy
5:50.251 infernal_strike Fluffy_Pillow 83.8/100: 84% pain immolation_aura, blood_frenzy
5:50.251 soul_cleave Fluffy_Pillow 83.8/100: 84% pain immolation_aura, blood_frenzy
5:51.577 shear Fluffy_Pillow 26.8/100: 27% pain immolation_aura
5:53.008 shear Fluffy_Pillow 41.9/100: 42% pain
5:54.438 shear Fluffy_Pillow 55.2/100: 55% pain
5:55.705 demon_spikes Fluffy_Pillow 49.0/100: 49% pain defensive_spikes, demon_spikes
5:55.870 shear Fluffy_Pillow 49.0/100: 49% pain defensive_spikes, demon_spikes
5:57.301 felblade Fluffy_Pillow 59.0/100: 59% pain defensive_spikes, demon_spikes
5:58.734 soul_cleave Fluffy_Pillow 81.0/100: 81% pain demon_spikes
6:00.165 immolation_aura Fluffy_Pillow 21.0/100: 21% pain demon_spikes
6:01.527 shear Fluffy_Pillow 31.0/100: 31% pain demon_spikes, immolation_aura
6:02.959 felblade Fluffy_Pillow 43.0/100: 43% pain immolation_aura, blood_frenzy
6:04.285 Waiting 0.600 sec 70.3/100: 70% pain raid_movement, immolation_aura, blood_frenzy
6:04.885 auto_attack Fluffy_Pillow 70.3/100: 70% pain immolation_aura, blood_frenzy
6:04.885 shear Fluffy_Pillow 70.3/100: 70% pain immolation_aura, blood_frenzy
6:06.210 soul_cleave Fluffy_Pillow 84.3/100: 84% pain blood_frenzy
6:06.711 fiery_brand Fluffy_Pillow 24.3/100: 24% pain blood_frenzy
6:07.536 infernal_strike Fluffy_Pillow 24.3/100: 24% pain blood_frenzy
6:07.536 soul_carver Fluffy_Pillow 24.3/100: 24% pain blood_frenzy
6:08.860 shear Fluffy_Pillow 26.3/100: 26% pain blood_frenzy
6:10.186 shear Fluffy_Pillow 36.3/100: 36% pain blood_frenzy
6:11.186 empower_wards Fluffy_Pillow 46.3/100: 46% pain empower_wards, blood_frenzy
6:11.512 soul_cleave Fluffy_Pillow 46.3/100: 46% pain empower_wards, blood_frenzy
6:12.838 shear Fluffy_Pillow 1.9/100: 2% pain empower_wards, blood_frenzy
6:14.162 immolation_aura Fluffy_Pillow 14.3/100: 14% pain empower_wards, blood_frenzy
6:14.762 demon_spikes Fluffy_Pillow 2.3/100: 2% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
6:15.330 sigil_of_flame Fluffy_Pillow 4.3/100: 4% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
6:16.498 felblade Fluffy_Pillow 10.3/100: 10% pain defensive_spikes, demon_spikes, empower_wards, immolation_aura, blood_frenzy
6:17.823 shear Fluffy_Pillow 32.3/100: 32% pain demon_spikes, immolation_aura, blood_frenzy
6:19.148 felblade Fluffy_Pillow 47.1/100: 47% pain demon_spikes, immolation_aura, blood_frenzy
6:20.473 infernal_strike Fluffy_Pillow 74.3/100: 74% pain raid_movement, demon_spikes
6:20.473 auto_attack Fluffy_Pillow 74.3/100: 74% pain demon_spikes
6:20.473 shear Fluffy_Pillow 74.3/100: 74% pain demon_spikes
6:20.773 demon_spikes Fluffy_Pillow 64.3/100: 64% pain defensive_spikes, demon_spikes
6:21.904 shear Fluffy_Pillow 64.3/100: 64% pain defensive_spikes, demon_spikes, blood_frenzy
6:23.229 shear Fluffy_Pillow 75.3/100: 75% pain defensive_spikes, demon_spikes, blood_frenzy
6:24.555 soul_cleave Fluffy_Pillow 88.5/100: 88% pain demon_spikes, blood_frenzy
6:25.880 shear Fluffy_Pillow 28.5/100: 28% pain demon_spikes, blood_frenzy
6:27.204 shear Fluffy_Pillow 41.6/100: 42% pain blood_frenzy
6:28.194 demon_spikes Fluffy_Pillow 32.6/100: 33% pain defensive_spikes, demon_spikes, blood_frenzy
6:28.529 immolation_aura Fluffy_Pillow 32.6/100: 33% pain defensive_spikes, demon_spikes, blood_frenzy
6:29.695 shear Fluffy_Pillow 42.6/100: 43% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:31.021 shear Fluffy_Pillow 55.6/100: 56% pain defensive_spikes, demon_spikes, immolation_aura, blood_frenzy
6:32.347 felblade Fluffy_Pillow 68.5/100: 69% pain demon_spikes, immolation_aura
6:33.966 soul_cleave Fluffy_Pillow 92.5/100: 93% pain demon_spikes, immolation_aura
6:35.396 shear Fluffy_Pillow 36.4/100: 36% pain

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8803 8478 0
Agility 24145 22520 13488 (9544)
Stamina 46683 46683 19893
Intellect 5328 5003 0
Spirit 2 2 0
Health 2913019 2913019 0
Pain 100 100 0
Crit 42.89% 41.82% 9036
Haste 5.09% 5.09% 1655
Damage / Heal Versatility 8.32% 8.32% 3328
Mitigation Versatility 4.16% 4.16% 3328
Attack Power 28522 26603 0
Mastery 13.60% 13.60% 3547
Armor 4492 4492 2042
Run Speed 7 0 0
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 14.52% 13.70% 0
Tank-Parry 15.15% 14.85% 9036
Tank-Block 0.00% 0.00% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 856.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }
Local Shoulders Otherworldy Leather Mantle
ilevel: 850, stats: { 247 Armor, +1459 Sta, +973 AgiInt, +594 Crit, +385 Mastery }
Local Chest Grove Keeper's Robe
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +904 Crit, +400 Haste }
Local Waist Steelgazer Hide Belt
ilevel: 835, stats: { 176 Armor, +846 AgiInt, +1269 Sta, +602 Haste, +324 Vers }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Dreadleather Footpads of the Quickblade
ilevel: 850, stats: { 226 Armor, +1459 Sta, +973 AgiInt, +490 Crit, +490 Vers }
Local Wrists Wristwraps of Broken Trust
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +445 Mastery, +288 Crit }
Local Hands Dreadleather Gloves of the Quickblade
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +279 Crit, +699 Vers }
Local Finger1 Dingy Suramar Mercantile Signet
ilevel: 865, stats: { +1258 Sta, +1387 Crit, +555 Vers }, enchant: { +150 Vers }
Local Finger2 Ring of Deep Sea Pearls
ilevel: 860, stats: { +1201 Sta, +1198 Mastery, +708 Vers }, enchant: { +150 Vers }
Local Trinket1 An'she's Token of Guile
ilevel: 850, stats: { +1233 Agi, +932 Crit }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }
Local Back Drape of the Mana-Starved
ilevel: 880, stats: { 145 Armor, +1448 Sta, +965 StrAgiInt, +569 Crit, +252 Vers }, enchant: { +200 Agi }
Local Main Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }, relics: { +39 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Aldrachi Warblades
ilevel: 865, weapon: { 3789 - 7038, 2.6 }, stats: { +639 Agi, +959 Sta, +300 Crit, +288 Mastery }

Talents

Level
15 Abyssal Strike (Vengeance Demon Hunter) Agonizing Flames (Vengeance Demon Hunter) Razor Spikes (Vengeance Demon Hunter)
30 Feast of Souls (Vengeance Demon Hunter) Fallout (Vengeance Demon Hunter) Burning Alive (Vengeance Demon Hunter)
45 Felblade Flame Crash (Vengeance Demon Hunter) Fel Eruption (Vengeance Demon Hunter)
60 Feed the Demon (Vengeance Demon Hunter) Fracture (Vengeance Demon Hunter) Soul Rending (Vengeance Demon Hunter)
75 Concentrated Sigils (Vengeance Demon Hunter) Sigil of Chains (Vengeance Demon Hunter) Quickened Sigils (Vengeance Demon Hunter)
90 Fel Devastation (Vengeance Demon Hunter) Blade Turning (Vengeance Demon Hunter) Spirit Bomb (Vengeance Demon Hunter)
100 Last Resort (Vengeance Demon Hunter) Nether Bond (Vengeance Demon Hunter) Soul Barrier (Vengeance Demon Hunter)

Profile

demonhunter="Illistan"
origin="https://us.api.battle.net/wow/character/thrall/Illistan/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/238/157220590-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=enchanting=59/herbalism=339
talents=2111111
artifact=60:0:0:0:0:1096:1:1101:3:1228:1:1229:3:1232:3:1233:3:1234:3:1328:1
spec=vengeance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=auto_attack
actions+=/fiery_brand,if=buff.demon_spikes.down&buff.metamorphosis.down
actions+=/demon_spikes,if=charges=2|buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down
actions+=/empower_wards,if=debuff.casting.up
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&artifact.fiery_demise.enabled&dot.fiery_brand.ticking
actions+=/infernal_strike,if=!sigil_placed&!in_flight&remains-travel_time-delay<0.3*duration&(!artifact.fiery_demise.enabled|(max_charges-charges_fractional)*recharge_time<cooldown.fiery_brand.remains+5)&(cooldown.sigil_of_flame.remains>7|charges=2)
actions+=/spirit_bomb,if=debuff.frailty.down
actions+=/soul_carver,if=dot.fiery_brand.ticking
actions+=/immolation_aura,if=pain<=80
actions+=/felblade,if=pain<=70
actions+=/soul_barrier
actions+=/soul_cleave,if=soul_fragments=5
actions+=/metamorphosis,if=buff.demon_spikes.down&!dot.fiery_brand.ticking&buff.metamorphosis.down&incoming_damage_5s>health.max*0.70
actions+=/fel_devastation,if=incoming_damage_5s>health.max*0.70
actions+=/soul_cleave,if=incoming_damage_5s>=health.max*0.70
actions+=/fel_eruption
actions+=/sigil_of_flame,if=remains-delay<=0.3*duration
actions+=/fracture,if=pain>=80&soul_fragments<4&incoming_damage_4s<=health.max*0.20
actions+=/soul_cleave,if=pain>=80
actions+=/shear

head=biornskin_hood,id=134196,bonus_id=1727/1527/3337
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1807/1472
back=drape_of_the_manastarved,id=141543,bonus_id=1492/3337,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1807/1808/1472
wrists=wristwraps_of_broken_trust,id=139209,bonus_id=1807/1472
hands=dreadleather_gloves,id=128886,bonus_id=689/1682/3408/601/669
waist=steelgazer_hide_belt,id=134155,bonus_id=3432/1497/1674
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=dreadleather_footpads,id=128885,bonus_id=689/1679/3408/600/669
finger1=dingy_suramar_mercantile_signet,id=141492,bonus_id=1808/1477/3336,enchant=150vers
finger2=ring_of_deep_sea_pearls,id=141545,bonus_id=1472,enchant=150vers
trinket1=anshes_token_of_guile,id=139113,bonus_id=3397/603/1512/3337
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1472
main_hand=aldrachi_warblades,id=128832,bonus_id=721,gem_id=141262/137303/142058/0,relic_id=3432:1497:1674/1727:1492:1813/0/0
off_hand=aldrachi_warblades,id=128831

# Gear Summary
# gear_ilvl=855.94
# gear_agility=13488
# gear_stamina=19893
# gear_crit_rating=9036
# gear_haste_rating=1655
# gear_mastery_rating=3547
# gear_versatility_rating=3328
# gear_armor=2042

Madarii

Madarii : 307651 dps, 182622 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Balance
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
307650.8 307650.8 346.9 / 0.113% 67134.0 / 21.8% 72424.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.2 4.2 Astral Power 9.64% 39.4 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Madarii/advanced
Talents
  • 15: Starlord (Balance Druid)
  • 30: Renewal
  • 45: Guardian Affinity (Balance Druid)
  • 60: Mass Entanglement
  • 75: Incarnation: Chosen of Elune
  • 90: Shooting Stars (Balance Druid)
  • 100: Nature's Balance (Balance Druid)
  • Talent Calculator
Artifact
Professions
  • alchemy: 800
  • herbalism: 815
Scale Factors for Madarii Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 12.78 8.78 7.60 7.09 4.52
Normalized 1.46 1.00 0.87 0.81 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.44 0.44 0.44 0.44 0.44
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Madarii": Intellect=8.78, CritRating=7.09, HasteRating=12.78, MasteryRating=4.52, Versatility=7.60 )

Scale Factors for other metrics

Scale Factors for Madarii Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 12.78 8.78 7.60 7.09 4.52
Normalized 1.46 1.00 0.87 0.81 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.44 0.44 0.44 0.44 0.44
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Madarii": Intellect=8.78, CritRating=7.09, HasteRating=12.78, MasteryRating=4.52, Versatility=7.60 )
Scale Factors for Madarii Priority Target Damage Per Second
Haste Int Vers Crit Mastery
Scale Factors 6.96 5.19 4.50 4.23 2.24
Normalized 1.34 1.00 0.87 0.82 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.14 0.15 0.15 0.15 0.15
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Madarii": Intellect=5.19, CritRating=4.23, HasteRating=6.96, MasteryRating=2.24, Versatility=4.50 )
Scale Factors for Madarii Damage Per Second (Effective)
Haste Int Vers Crit Mastery
Scale Factors 12.78 8.78 7.60 7.09 4.52
Normalized 1.46 1.00 0.87 0.81 0.51
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Int > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Madarii": Intellect=8.78, CritRating=7.09, HasteRating=12.78, MasteryRating=4.52, Versatility=7.60 )
Scale Factors for Madarii Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for Madarii Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )
Scale Factors for MadariiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Madarii": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Madarii 307651
Deadly Grace 10046 3.2% 27.1 8.38sec 146178 0 Direct 27.0 117370 239476 146970 24.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.13 26.98 0.00 0.00 0.0000 0.0000 3965266.55 3965266.55 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.44 75.76% 117370.06 90361 121987 117352.63 108433 121987 2399090 2399090 0.00
crit 6.54 24.24% 239476.25 184336 248853 239278.60 0 248853 1566176 1566176 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Full Moon 18911 6.2% 7.8 54.26sec 972330 389704 Direct 16.5 365775 740973 457063 24.3%  

Stats details: full_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.76 16.51 0.00 0.00 2.4952 0.0000 7545448.27 5999206.70 -25.77 389703.97 389703.97
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.49 75.67% 365774.82 115862 938483 377216.67 115862 695172 4569437 3624670 -27.24
crit 4.02 24.33% 740972.89 236359 1418151 750408.02 0 1418151 2976011 2374536 -38.41
 
 

Action details: full_moon

Static Values
  • id:202771
  • school:astral
  • resource:none
  • range:40.0
  • travel_speed:0.9000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
Spelldata
  • id:202771
  • name:Full Moon
  • school:astral
  • tooltip:
  • description:Deals $m1 Astral damage to the target and reduced damage to all other nearby enemies, and resets Full Moon to become New Moon. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:18.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Half Moon 8770 2.9% 8.1 51.56sec 434060 259919 Direct 8.1 348108 709906 435486 24.2%  

Stats details: half_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.08 8.06 0.00 0.00 1.6701 0.0000 3508380.59 3508380.59 0.00 259918.55 259918.55
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.11 75.85% 348108.19 347587 469242 348074.08 347587 382345 2127120 2127120 0.00
crit 1.95 24.15% 709905.78 709077 957254 628342.91 0 957254 1381260 1381260 0.00
 
 

Action details: half_moon

Static Values
  • id:202768
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
Spelldata
  • id:202768
  • name:Half Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers Half Moon to become Full Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:9.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Lunar Strike 72307 23.4% 63.5 6.10sec 451065 233659 Direct 292.3 69666 142052 97991 39.1%  

Stats details: lunar_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.50 292.29 0.00 0.00 1.9304 0.0000 28642165.83 28642165.83 0.00 233659.10 233659.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.91 60.87% 69666.14 40692 265789 69654.57 59282 82073 12394445 12394445 0.00
crit 114.38 39.13% 142052.17 83012 542209 142030.30 114062 172030 16247720 16247720 0.00
 
 

Action details: lunar_strike

Static Values
  • id:194153
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.50
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.lunar_empowerment.stack=3
Spelldata
  • id:194153
  • name:Lunar Strike
  • school:arcane
  • tooltip:
  • description:Call down a strike of lunar energy, causing {$s1=0 + 284.0%} Arcane damage to the target, and ${$m1*$m3/100} Arcane damage to all other enemies within $A1 yards. |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.840000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Moonfire 23890 7.8% 18.8 22.01sec 508369 416444 Direct 18.8 51017 104006 63765 24.1%  
Periodic 252.4 26476 54023 33125 24.1% 99.8%

Stats details: moonfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.81 18.81 252.43 252.43 1.2208 1.5832 9560730.36 9560730.36 0.00 22623.27 416444.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.28 75.94% 51017.29 46732 112850 51005.79 46732 63987 728649 728649 0.00
crit 4.52 24.06% 104006.28 95334 230214 103316.60 0 230214 470567 470567 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 191.5 75.87% 26476.47 5936 56427 26487.63 25277 27716 5070410 5070410 0.00
crit 60.9 24.13% 54023.29 7155 115110 54041.48 49185 61319 3291105 3291105 0.00
 
 

Action details: moonfire

Static Values
  • id:8921
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
Spelldata
  • id:8921
  • name:Moonfire
  • school:arcane
  • tooltip:
  • description:A quick beam of lunar light burns the enemy for {$164812s1=1 + 110.0%} Arcane damage and then an additional $164812o2 Arcane damage over {$164812d=16 seconds}.{$?s5487=true}[ Usable while in Bear Form.][]{$?s197911=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
New Moon 4567 1.5% 7.4 51.47sec 246505 197800 Direct 8.4 174113 355144 217926 24.2%  

Stats details: new_moon

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.42 8.39 0.00 0.00 1.2463 0.0000 1828858.37 1828858.37 0.00 197799.95 197799.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.36 75.80% 174113.23 173794 234622 174096.86 173794 194070 1107559 1107559 0.00
crit 2.03 24.20% 355144.30 354540 478628 317920.11 0 478628 721300 721300 0.00
 
 

Action details: new_moon

Static Values
  • id:202767
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202767
  • name:New Moon
  • school:arcane
  • tooltip:
  • description:Deals $m1 Astral damage to the target and empowers New Moon to become Half Moon. |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shooting Stars 2959 1.0% 77.8 5.37sec 15215 0 Direct 54.4 17378 35460 21740 24.1%  

Stats details: shooting_stars

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.78 54.44 0.00 0.00 0.0000 0.0000 1183506.77 1183506.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.31 75.88% 17378.35 16221 21898 17378.28 16221 18973 717894 717894 0.00
crit 13.13 24.12% 35460.17 33090 44672 35454.12 33090 41776 465613 465613 0.00
 
 

Action details: shooting_stars

Static Values
  • id:202497
  • school:astral
  • resource:none
  • range:50000.0
  • travel_speed:0.8000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202497
  • name:Shooting Stars
  • school:astral
  • tooltip:
  • description:{$@spelldesc202342=Moonfire and Sunfire damage over time has a {$s1=10}% chance to call down a falling star, dealing $202497m1 Astral damage and generating ${$202497m2/10} Astral Power.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.420000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Solar Wrath 24890 8.3% 78.6 5.04sec 129216 107570 Direct 77.9 104194 212341 130350 24.2%  

Stats details: solar_wrath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 78.63 77.95 0.00 0.00 1.2012 0.0000 10160734.21 10160734.21 0.00 107569.94 107569.94
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 59.10 75.81% 104194.25 81877 187178 104949.72 91920 131486 6157664 6157664 0.00
crit 18.85 24.19% 212341.13 167029 381843 213879.37 167029 342245 4003070 4003070 0.00
 
 

Action details: solar_wrath

Static Values
  • id:190984
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.solar_empowerment.stack=3
Spelldata
  • id:190984
  • name:Solar Wrath
  • school:nature
  • tooltip:
  • description:Hurl a ball of solar energy at the target, dealing {$s1=1} Nature damage.$?a197911[ |cFFFFFFFFGenerates ${$m2/10} Astral Power.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Starfall 55831 18.0% 15.2 19.56sec 1452559 1240181 Periodic 691.6 25487 51986 31871 24.1% 0.0%

Stats details: starfall

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.17 0.00 0.00 691.60 1.1713 0.0000 22041735.21 22041735.21 0.00 1240180.90 1240180.90
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 525.0 75.91% 25487.19 23168 31277 25494.88 24155 26636 13380835 13380835 0.00
crit 166.6 24.09% 51986.02 47263 63806 51999.97 49101 55336 8660900 8660900 0.00
 
 

Action details: starfall

Static Values
  • id:191034
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.oneths_overconfidence.up
Spelldata
  • id:191034
  • name:Starfall
  • school:astral
  • tooltip:Calling down falling stars at the targeted area.
  • description:Calls down waves of falling stars at the targeted area, dealing ${9*$191037m1} Astral damage over {$191034d=8 seconds}.$?a231049[ Also applies Stellar Empowerment to each target, which increases damage taken from your Moonfire and Sunfire by {$197637s1=20}%.][]
 
Starsurge 18508 (21824) 6.1% (7.2%) 19.5 20.71sec 450201 373008 Direct 19.4 255019 520515 383197 48.3%  

Stats details: starsurge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.52 19.45 0.00 0.00 1.2070 0.0000 7451362.65 7451362.65 0.00 373008.15 373008.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.06 51.72% 255019.25 236951 319883 255156.49 236951 319883 2564902 2564902 0.00
crit 9.39 48.28% 520514.67 483379 652562 520777.87 0 652562 4886460 4886460 0.00
 
 

Action details: starsurge

Static Values
  • id:78674
  • school:astral
  • resource:astral_power
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.24
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies<=2
Spelldata
  • id:78674
  • name:Starsurge
  • school:astral
  • tooltip:
  • description:Launch a surge of stellar energies at the target, dealing {$78674s1=1} Astral damage. Also grants you Lunar and Solar Empowerments, which increase the damage of your next Lunar Strike and Solar Wrath by {$164547s1=20}%, respectively.$?a231021[ You can accumulate up to {$164547u=1} of each Empowerment.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Goldrinn's Fang 3316 1.1% 6.5 57.81sec 206695 0 Direct 6.4 166293 339368 207792 24.0%  

Stats details: goldrinns_fang

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.46 6.43 0.00 0.00 0.0000 0.0000 1335590.41 1335590.41 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.89 76.02% 166293.04 154482 208551 165188.68 0 208551 812564 812564 0.00
crit 1.54 23.98% 339367.73 315144 425445 267873.80 0 425445 523026 523026 0.00
 
 

Action details: goldrinns_fang

Static Values
  • id:203001
  • school:arcane
  • resource:none
  • range:60.0
  • travel_speed:20.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203001
  • name:Goldrinn's Fang
  • school:arcane
  • tooltip:Deals $m1 Arcane damage.
  • description:Deals $m1 Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:4.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Sunfire 49815 16.1% 14.4 24.32sec 1372224 1141083 Direct 65.5 47379 96629 59237 24.1%  
Periodic 525.6 24173 49324 30232 24.1% 210.0%

Stats details: sunfire

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.41 65.47 525.63 525.63 1.2026 1.6001 19769270.57 19769270.57 0.00 23030.88 1141083.44
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.71 75.92% 47379.47 42484 102591 47380.22 42484 64395 2355010 2355010 0.00
crit 15.76 24.08% 96629.47 86667 209286 96665.06 86667 146248 1523216 1523216 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 399.0 75.91% 24173.02 89 51297 24170.07 22757 26134 9644940 9644940 0.00
crit 126.6 24.09% 49323.93 182 104646 49317.07 45204 55312 6246105 6246105 0.00
 
 

Action details: sunfire

Static Values
  • id:93402
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
Spelldata
  • id:93402
  • name:Sunfire
  • school:nature
  • tooltip:Suffering $w2 Nature damage every $t2 sec.
  • description:A quick beam of solar light burns the enemy for {$164815s1=1} Nature damage and then an additional $164815o2 Nature damage over {$164815d=12 seconds}{$?s231050=true}[ to the primary target and all enemies within $164815A2 yards][].{$?s137013=false}[ |cFFFFFFFFGenerates ${$m3/10} Astral Power.|r][]
 
Tormenting Cyclone 13841 4.5% 14.3 27.14sec 384372 0 Direct 339.8 12914 26353 16153 24.1%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.28 339.83 0.00 0.00 0.0000 0.0000 5489232.06 5489232.06 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 257.94 75.90% 12914.48 12041 16255 12909.15 12041 15327 3331136 3331136 0.00
crit 81.89 24.10% 26352.95 24563 33160 26344.21 24563 31361 2158096 2158096 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Simple Action Stats Execute Interval
Madarii
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Madarii
  • harmful:false
  • if_expr:
 
Incarnation: Chosen of Elune (incarnation) 2.6 185.08sec

Stats details: incarnation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: incarnation

Static Values
  • id:102560
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:astral_power>=40
Spelldata
  • id:102560
  • name:Incarnation: Chosen of Elune
  • school:physical
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases the damage of all your spells by {$s1=35}% and causes your Lunar Strike and Solar Wrath to generate {$s4=50}% additional Astral Power. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
 
Moonkin Form 1.0 0.00sec

Stats details: moonkin_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: moonkin_form

Static Values
  • id:24858
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:24858
  • name:Moonkin Form
  • school:physical
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 43.29% 0.0(0.0) 1.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Incarnation: Chosen of Elune 2.6 0.0 185.1sec 185.1sec 18.99% 18.99% 0.0(0.0) 2.5

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_incarnation_chosen_of_elune
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.35

Stack Uptimes

  • incarnation_chosen_of_elune_1:18.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:102560
  • name:Incarnation: Chosen of Elune
  • tooltip:Incarnation: Chosen of Elune activated.
  • description:An improved Moonkin Form that increases the damage of all your spells by {$s1=35}% and causes your Lunar Strike and Solar Wrath to generate {$s4=50}% additional Astral Power. Lasts {$d=30 seconds}. You may shapeshift in and out of this improved Moonkin Form for its duration.
  • max_stacks:0
  • duration:30.00
  • cooldown:180.00
  • default_chance:101.00%
Lunar Empowerment 17.2 2.3 23.5sec 20.7sec 26.26% 26.47% 2.3(2.3) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_lunar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.33

Stack Uptimes

  • lunar_empowerment_1:26.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164547
  • name:Lunar Empowerment
  • tooltip:The damage of your next Lunar Strike is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Lunar Strike within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 188.2sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Solar Empowerment 18.3 1.2 22.1sec 20.7sec 14.69% 24.37% 1.2(1.2) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_solar_empowerment
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.33

Stack Uptimes

  • solar_empowerment_1:14.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:164545
  • name:Solar Empowerment
  • tooltip:The damage of your next Solar Wrath is increased by $w1%$?$w2>0[, and its cast time is reduced by $w2%][].
  • description:Increases the damage of your next Solar Wrath within {$d=40 seconds} by {$s1=20}%.
  • max_stacks:1
  • duration:40.00
  • cooldown:0.00
  • default_chance:100.00%
Star Power 2.6 46.8 185.4sec 6.8sec 18.56% 20.40% 0.0(0.0) 0.0

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_star_power
  • max_stacks:50
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • star_power_1:1.18%
  • star_power_2:1.21%
  • star_power_3:0.52%
  • star_power_4:0.97%
  • star_power_5:0.78%
  • star_power_6:1.16%
  • star_power_7:1.09%
  • star_power_8:1.04%
  • star_power_9:1.15%
  • star_power_10:1.15%
  • star_power_11:0.74%
  • star_power_12:0.74%
  • star_power_13:0.65%
  • star_power_14:1.88%
  • star_power_15:0.76%
  • star_power_16:0.50%
  • star_power_17:1.06%
  • star_power_18:0.49%
  • star_power_19:0.43%
  • star_power_20:0.27%
  • star_power_21:0.53%
  • star_power_22:0.21%
  • star_power_23:0.07%
  • star_power_24:0.01%
  • star_power_25:0.00%
  • star_power_26:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202942
  • name:Star Power
  • tooltip:Increases haste by ${$w1}.1%.
  • description:
  • max_stacks:50
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Moonkin Form

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_moonkin_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • moonkin_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:24858
  • name:Moonkin Form
  • tooltip:Arcane and Nature damage done increased by {$s8=10}%. Immune to Polymorph effects.$?$w3>0[ Armor increased by $w3%.][]
  • description:Shapeshift into {$?s114301=false}[Astral Form][Moonkin Form], increasing your Arcane and Nature damage by {$s8=10}% and your armor by $m3%, and granting protection from Polymorph effects.$?a231042[ While in this form, single-target attacks against you have a {$h=0}% chance make your next Lunar Strike, Solar Wrath or Stellar Flare instant.][] The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Madarii
starfall Astral Power 15.2 910.5 60.0 60.0 24208.8
starsurge Astral Power 19.5 780.7 40.0 40.0 11255.4
Resource Gains Type Count Total Average Overflow
new_moon Astral Power 8.42 84.18 (4.91%) 10.00 0.01 0.01%
half_moon Astral Power 8.08 161.59 (9.42%) 19.99 0.06 0.04%
full_moon Astral Power 7.76 309.92 (18.07%) 39.94 0.48 0.16%
shooting_stars Astral Power 77.78 311.08 (18.14%) 4.00 0.05 0.02%
lunar_strike Astral Power 63.50 847.95 (49.45%) 13.35 0.00 0.00%
Resource RPS-Gain RPS-Loss
Astral Power 4.28 4.22
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 100.00 100.00 100.00
Astral Power 23.62 0.00 66.00
Combo Points 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %
Astral Power Cap 0.0%

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Madarii Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Madarii Damage Per Second
Count 9999
Mean 307650.76
Minimum 264602.99
Maximum 380344.30
Spread ( max - min ) 115741.30
Range [ ( max - min ) / 2 * 100% ] 18.81%
Standard Deviation 17698.0166
5th Percentile 282301.29
95th Percentile 339670.63
( 95th Percentile - 5th Percentile ) 57369.34
Mean Distribution
Standard Deviation 176.9890
95.00% Confidence Intervall ( 307303.87 - 307997.65 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 127
0.1% Error 12712
0.1 Scale Factor Error with Delta=300 2673824
0.05 Scale Factor Error with Delta=300 10695297
0.01 Scale Factor Error with Delta=300 267382430
Priority Target DPS
Sample Data Madarii Priority Target Damage Per Second
Count 9999
Mean 182622.36
Minimum 161203.00
Maximum 207702.50
Spread ( max - min ) 46499.50
Range [ ( max - min ) / 2 * 100% ] 12.73%
Standard Deviation 5913.0431
5th Percentile 173015.12
95th Percentile 192380.02
( 95th Percentile - 5th Percentile ) 19364.91
Mean Distribution
Standard Deviation 59.1334
95.00% Confidence Intervall ( 182506.46 - 182738.26 )
Normalized 95.00% Confidence Intervall ( 99.94% - 100.06% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 40
0.1% Error 4027
0.1 Scale Factor Error with Delta=300 298473
0.05 Scale Factor Error with Delta=300 1193893
0.01 Scale Factor Error with Delta=300 29847348
DPS(e)
Sample Data Madarii Damage Per Second (Effective)
Count 9999
Mean 307650.76
Minimum 264602.99
Maximum 380344.30
Spread ( max - min ) 115741.30
Range [ ( max - min ) / 2 * 100% ] 18.81%
Damage
Sample Data Madarii Damage
Count 9999
Mean 122482281.87
Minimum 98946272.57
Maximum 147028127.06
Spread ( max - min ) 48081854.50
Range [ ( max - min ) / 2 * 100% ] 19.63%
DTPS
Sample Data Madarii Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Madarii Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Madarii Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Madarii Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Madarii Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Madarii Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MadariiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Madarii Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 moonkin_form
4 0.00 blessing_of_elune
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=deadly_grace
7 0.00 new_moon
Default action list Executed every time the actor is available.
# count action,conditions
8 1.00 potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
0.00 blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
0.00 blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 berserking,if=buff.celestial_alignment.up|buff.incarnation.up
0.00 arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
9 0.00 call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
A 0.00 call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
B 0.09 new_moon,if=(charges=2&recharge_time<5)|charges=3
C 0.17 half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
D 0.42 full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
0.00 stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
E 18.81 moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
F 14.41 sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
0.00 astral_communion,if=astral_power.deficit>=75
G 2.65 incarnation,if=astral_power>=40
0.00 celestial_alignment,if=astral_power>=40
0.00 starfall,if=buff.oneths_overconfidence.up
0.00 solar_wrath,if=buff.solar_empowerment.stack=3
0.00 lunar_strike,if=buff.lunar_empowerment.stack=3
H 0.00 call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
I 0.00 call_action_list,name=single_target
actions.celestial_alignment_phase
# count action,conditions
J 3.91 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
K 4.26 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
L 4.36 solar_wrath,if=buff.solar_empowerment.up
M 4.80 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
N 13.95 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
O 21.02 solar_wrath
actions.single_target
# count action,conditions
P 7.68 new_moon,if=astral_power<=90
Q 9.70 half_moon,if=astral_power<=80
R 9.97 full_moon,if=astral_power<=60
S 11.27 starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
T 15.25 starsurge,if=active_enemies<=2
0.00 warrior_of_elune
0.00 lunar_strike,if=buff.warrior_of_elune.up
U 16.49 solar_wrath,if=buff.solar_empowerment.up
V 16.76 lunar_strike,if=buff.lunar_empowerment.up
0.00 solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
W 39.04 lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
X 47.00 solar_wrath

Sample Sequence

012367EFQRGKLMKLMOOOOOOOOENJNNNNJNNFPQSWEXXRTUVVWFWPSEWWWTUVQFXXWEWWQSWWFWTUVQTEUUVWFWRWSWEXXXRTUUVWFWSPEWWWSXXXXQXXXWEFWSRSWWWG8KFLMEOOONNNJNNNFJENBQTRTUVVWFWEPSWWWWTUVFQTEUVWWRSWFWTUVEPVXXWWSFQWWEWTUVTRUVFXXXXXEXXRXXXXXXXXXXREXXXXXXXXRTUVTUVEXXPXXXXXXXXXXXQGKEL

Sample Sequence Table

time name target resources buffs
Pre flask Madarii 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre food Madarii 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre augmentation Madarii 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre moonkin_form Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
Pre potion Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 new_moon Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:00.000 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage potion_of_deadly_grace
0:01.192 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:02.155 half_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:03.441 full_moon Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:05.366 incarnation Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage bloodlust, potion_of_deadly_grace
0:05.366 starsurge Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, potion_of_deadly_grace
0:06.331 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power, potion_of_deadly_grace
0:07.095 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(2), potion_of_deadly_grace
0:08.356 starsurge Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(3), potion_of_deadly_grace
0:09.293 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(4), potion_of_deadly_grace
0:10.037 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, lunar_empowerment, star_power(5), potion_of_deadly_grace
0:11.261 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(6), potion_of_deadly_grace
0:12.171 Waiting 1.000 sec 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, incarnation_chosen_of_elune, star_power(6), potion_of_deadly_grace
0:13.171 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(6), potion_of_deadly_grace
0:14.082 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
0:14.983 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(8), potion_of_deadly_grace
0:15.877 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(9), potion_of_deadly_grace
0:16.763 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(10), potion_of_deadly_grace
0:17.640 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(11), potion_of_deadly_grace
0:18.508 solar_wrath Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(12), potion_of_deadly_grace
0:19.370 moonfire Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(13), potion_of_deadly_grace
0:20.222 Waiting 3.400 sec 38.0/100: 38% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, incarnation_chosen_of_elune, star_power(14), potion_of_deadly_grace
0:23.622 lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(14)
0:25.031 starfall Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(15)
0:25.871 lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(16)
0:27.255 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(17)
0:28.082 Waiting 1.100 sec 26.0/100: 26% astral_power | 0.0/100: 0% rage bloodlust, raid_movement, incarnation_chosen_of_elune, star_power(17)
0:29.182 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(17)
0:30.554 lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(18)
0:31.915 starfall Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(19)
0:32.725 lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(20)
0:34.065 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage bloodlust, incarnation_chosen_of_elune, star_power(21)
0:35.393 sunfire Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage bloodlust
0:36.357 new_moon Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage bloodlust
0:37.320 half_moon Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage bloodlust
0:38.605 starfall Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage bloodlust
0:39.569 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage bloodlust
0:41.173 moonfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
0:42.426 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
0:43.677 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
0:44.929 Waiting 0.300 sec 26.0/100: 26% astral_power | 0.0/100: 0% rage raid_movement
0:45.229 full_moon Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
0:47.731 starsurge Fluffy_Pillow 66.0/100: 66% astral_power | 0.0/100: 0% rage
0:48.983 solar_wrath Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
0:49.986 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
0:50.989 Waiting 2.600 sec 26.0/100: 26% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
0:53.589 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage lunar_empowerment
0:55.259 lunar_strike Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
0:57.344 sunfire Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
0:58.597 lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
1:00.005 Waiting 1.200 sec 54.0/100: 54% astral_power | 0.0/100: 0% rage raid_movement
1:01.205 new_moon Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
1:02.459 starfall Fluffy_Pillow 64.0/100: 64% astral_power | 0.0/100: 0% rage
1:03.712 moonfire Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage
1:04.965 lunar_strike Fluffy_Pillow 4.0/100: 4% astral_power | 0.0/100: 0% rage
1:07.051 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
1:09.137 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:11.223 starsurge Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
1:12.475 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:13.480 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
1:15.149 half_moon Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
1:16.401 sunfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement
1:17.652 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
1:18.903 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
1:20.155 Waiting 3.500 sec 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement
1:23.655 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
1:25.741 moonfire Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
1:26.994 lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
1:29.078 lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage
1:31.164 half_moon Fluffy_Pillow 68.0/100: 68% astral_power | 0.0/100: 0% rage
1:32.416 starfall Fluffy_Pillow 68.0/100: 68% astral_power | 0.0/100: 0% rage raid_movement
1:33.668 lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage
1:35.753 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
1:37.836 sunfire Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:39.089 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
1:41.174 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
1:42.426 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:43.429 lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
1:45.097 half_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
1:46.766 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
1:48.017 moonfire Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
1:49.272 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:50.273 Waiting 3.300 sec 0.0/100: 0% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
1:53.573 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
1:54.576 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment
1:56.245 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage
1:58.329 sunfire Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
1:59.584 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
2:01.668 full_moon Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage
2:04.005 Waiting 1.200 sec 56.0/100: 56% astral_power | 0.0/100: 0% rage raid_movement
2:05.205 lunar_strike Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage
2:07.290 starfall Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage
2:08.543 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage
2:10.628 moonfire Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:11.880 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:13.131 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:14.382 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:15.635 full_moon Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage
2:18.137 starsurge Fluffy_Pillow 64.0/100: 64% astral_power | 0.0/100: 0% rage
2:19.391 solar_wrath Fluffy_Pillow 24.0/100: 24% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:20.393 Waiting 0.300 sec 24.0/100: 24% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
2:20.693 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
2:21.697 lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment
2:23.366 lunar_strike Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
2:25.452 sunfire Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
2:26.703 lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
2:28.789 starfall Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage
2:30.041 new_moon Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
2:31.294 moonfire Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
2:32.547 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
2:34.634 lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:36.004 Waiting 1.200 sec 50.0/100: 50% astral_power | 0.0/100: 0% rage raid_movement
2:37.204 lunar_strike Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
2:39.287 starfall Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage
2:40.540 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
2:41.792 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
2:43.045 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
2:44.298 solar_wrath Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
2:45.550 half_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
2:47.218 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
2:48.471 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
2:49.723 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
2:50.975 Waiting 1.600 sec 34.0/100: 34% astral_power | 0.0/100: 0% rage raid_movement
2:52.575 lunar_strike Fluffy_Pillow 42.0/100: 42% astral_power | 0.0/100: 0% rage
2:54.661 moonfire Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
2:55.913 sunfire Fluffy_Pillow 54.0/100: 54% astral_power | 0.0/100: 0% rage
2:57.166 lunar_strike Fluffy_Pillow 58.0/100: 58% astral_power | 0.0/100: 0% rage
2:59.253 starfall Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage
3:00.507 full_moon Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
3:03.009 starfall Fluffy_Pillow 74.0/100: 74% astral_power | 0.0/100: 0% rage
3:04.260 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage
3:06.346 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
3:08.005 Waiting 1.200 sec 34.0/100: 34% astral_power | 0.0/100: 0% rage raid_movement
3:09.205 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
3:11.290 incarnation Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
3:11.290 potion Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune
3:11.290 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, potion_of_deadly_grace
3:12.544 sunfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power, potion_of_deadly_grace
3:13.783 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(2), potion_of_deadly_grace
3:14.766 lunar_strike Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, lunar_empowerment, star_power(3), potion_of_deadly_grace
3:16.387 moonfire Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(4), potion_of_deadly_grace
3:17.592 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(5), potion_of_deadly_grace
3:18.786 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(6), potion_of_deadly_grace
3:19.968 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:21.140 Waiting 2.500 sec 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement, incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:23.640 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:24.812 Waiting 0.400 sec 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement, incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:25.212 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(7), potion_of_deadly_grace
3:27.161 lunar_strike Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(8), potion_of_deadly_grace
3:29.093 starfall Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(9), potion_of_deadly_grace
3:30.242 lunar_strike Fluffy_Pillow 12.0/100: 12% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(10), potion_of_deadly_grace
3:32.137 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(11), potion_of_deadly_grace
3:34.017 lunar_strike Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(12), potion_of_deadly_grace
3:35.880 sunfire Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(13), potion_of_deadly_grace
3:36.989 starfall Fluffy_Pillow 70.0/100: 70% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(14)
3:38.088 moonfire Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(15)
3:39.179 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(16)
3:40.261 Waiting 0.900 sec 18.0/100: 18% astral_power | 0.0/100: 0% rage raid_movement, incarnation_chosen_of_elune, star_power(16)
3:41.161 new_moon Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, star_power(16)
3:42.241 half_moon Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
3:43.912 starsurge Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
3:45.165 full_moon Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:47.667 starsurge Fluffy_Pillow 56.0/100: 56% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:48.920 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
3:49.922 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
3:50.924 Waiting 2.700 sec 20.0/100: 20% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
3:53.624 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage lunar_empowerment
3:55.293 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
3:56.546 sunfire Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement
3:57.796 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
3:59.881 moonfire Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
4:01.134 new_moon Fluffy_Pillow 52.0/100: 52% astral_power | 0.0/100: 0% rage
4:02.388 starfall Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage
4:03.641 lunar_strike Fluffy_Pillow 2.0/100: 2% astral_power | 0.0/100: 0% rage
4:05.727 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage
4:07.812 lunar_strike Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
4:09.896 lunar_strike Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
4:11.982 starsurge Fluffy_Pillow 58.0/100: 58% astral_power | 0.0/100: 0% rage
4:13.237 solar_wrath Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:14.239 lunar_strike Fluffy_Pillow 18.0/100: 18% astral_power | 0.0/100: 0% rage lunar_empowerment
4:15.908 sunfire Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
4:17.163 half_moon Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
4:18.834 starsurge Fluffy_Pillow 50.0/100: 50% astral_power | 0.0/100: 0% rage
4:20.086 Waiting 1.000 sec 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
4:21.086 moonfire Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
4:22.338 Waiting 1.300 sec 10.0/100: 10% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
4:23.638 solar_wrath Fluffy_Pillow 10.0/100: 10% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:24.640 lunar_strike Fluffy_Pillow 14.0/100: 14% astral_power | 0.0/100: 0% rage lunar_empowerment
4:26.310 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:28.003 Waiting 1.200 sec 26.0/100: 26% astral_power | 0.0/100: 0% rage raid_movement
4:29.203 lunar_strike Fluffy_Pillow 26.0/100: 26% astral_power | 0.0/100: 0% rage
4:31.290 full_moon Fluffy_Pillow 38.0/100: 38% astral_power | 0.0/100: 0% rage
4:33.792 starfall Fluffy_Pillow 82.0/100: 82% astral_power | 0.0/100: 0% rage
4:35.045 lunar_strike Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage
4:37.132 sunfire Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
4:38.385 lunar_strike Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
4:40.470 starsurge Fluffy_Pillow 46.0/100: 46% astral_power | 0.0/100: 0% rage
4:41.723 solar_wrath Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
4:42.724 lunar_strike Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment
4:44.004 moonfire Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment
4:45.256 new_moon Fluffy_Pillow 6.0/100: 6% astral_power | 0.0/100: 0% rage lunar_empowerment
4:46.509 lunar_strike Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage lunar_empowerment
4:48.177 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
4:49.431 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
4:50.682 Waiting 2.900 sec 28.0/100: 28% astral_power | 0.0/100: 0% rage raid_movement
4:53.582 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage
4:55.668 lunar_strike Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
4:57.753 starfall Fluffy_Pillow 60.0/100: 60% astral_power | 0.0/100: 0% rage
4:59.004 sunfire Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
5:00.257 Waiting 0.900 sec 0.0/100: 0% astral_power | 0.0/100: 0% rage raid_movement
5:01.157 half_moon Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage
5:02.826 lunar_strike Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:04.912 lunar_strike Fluffy_Pillow 36.0/100: 36% astral_power | 0.0/100: 0% rage
5:06.998 moonfire Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
5:08.250 lunar_strike Fluffy_Pillow 48.0/100: 48% astral_power | 0.0/100: 0% rage
5:10.335 starsurge Fluffy_Pillow 68.0/100: 68% astral_power | 0.0/100: 0% rage
5:11.588 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:12.588 lunar_strike Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage lunar_empowerment
5:14.257 starsurge Fluffy_Pillow 40.0/100: 40% astral_power | 0.0/100: 0% rage
5:15.508 full_moon Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:16.760 Waiting 0.400 sec 0.0/100: 0% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
5:17.160 solar_wrath Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
5:18.163 lunar_strike Fluffy_Pillow 0.0/100: 0% astral_power | 0.0/100: 0% rage lunar_empowerment
5:19.831 sunfire Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:21.082 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:22.336 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:23.589 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:24.843 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:26.095 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:27.348 moonfire Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:28.601 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:29.852 solar_wrath Fluffy_Pillow 16.0/100: 16% astral_power | 0.0/100: 0% rage
5:31.105 full_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:32.357 Waiting 0.800 sec 20.0/100: 20% astral_power | 0.0/100: 0% rage raid_movement
5:33.157 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:34.410 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:35.662 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:36.913 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:38.166 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:39.417 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:40.671 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:41.924 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:43.177 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:44.430 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:45.684 full_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
5:48.005 Waiting 1.000 sec 28.0/100: 28% astral_power | 0.0/100: 0% rage raid_movement
5:49.005 moonfire Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage raid_movement
5:50.257 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:51.509 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:52.762 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:54.013 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:55.267 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:56.518 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:57.770 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
5:59.023 solar_wrath Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
6:00.276 full_moon Fluffy_Pillow 28.0/100: 28% astral_power | 0.0/100: 0% rage
6:02.776 starsurge Fluffy_Pillow 72.0/100: 72% astral_power | 0.0/100: 0% rage
6:04.029 Waiting 1.200 sec 32.0/100: 32% astral_power | 0.0/100: 0% rage raid_movement, lunar_empowerment, solar_empowerment
6:05.229 solar_wrath Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:06.233 lunar_strike Fluffy_Pillow 32.0/100: 32% astral_power | 0.0/100: 0% rage lunar_empowerment
6:07.903 starsurge Fluffy_Pillow 44.0/100: 44% astral_power | 0.0/100: 0% rage
6:09.155 solar_wrath Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment, solar_empowerment
6:10.158 lunar_strike Fluffy_Pillow 8.0/100: 8% astral_power | 0.0/100: 0% rage lunar_empowerment
6:11.826 moonfire Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:13.079 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:14.331 solar_wrath Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:15.584 new_moon Fluffy_Pillow 20.0/100: 20% astral_power | 0.0/100: 0% rage
6:16.837 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:18.088 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:19.341 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:20.595 Waiting 0.600 sec 30.0/100: 30% astral_power | 0.0/100: 0% rage raid_movement
6:21.195 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:22.447 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:23.698 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:24.949 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:26.201 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:27.453 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:28.705 solar_wrath Fluffy_Pillow 30.0/100: 30% astral_power | 0.0/100: 0% rage
6:29.958 solar_wrath Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
6:31.211 half_moon Fluffy_Pillow 34.0/100: 34% astral_power | 0.0/100: 0% rage
6:32.882 incarnation Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage
6:32.882 starsurge Fluffy_Pillow 62.0/100: 62% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune
6:34.134 moonfire Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power
6:35.374 solar_wrath Fluffy_Pillow 22.0/100: 22% astral_power | 0.0/100: 0% rage incarnation_chosen_of_elune, lunar_empowerment, solar_empowerment, star_power(2)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 9553 9228 200
Stamina 33878 33878 20808
Intellect 33839 32132 23277 (11072)
Spirit 0 0 0
Health 2032680 2032680 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 33839 32132 0
Crit 24.12% 24.12% 6693
Haste 20.10% 18.95% 6158
Damage / Heal Versatility 3.75% 3.75% 1502
Attack Power 9553 9228 0
Mastery 36.34% 36.34% 3558
Armor 6207 2069 2069
Run Speed 7 0 0
Leech 1.86% 1.86% 427

Gear

Source Slot Average Item Level: 857.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Chain of Scorched Bones
ilevel: 850, stats: { +1094 Sta, +1206 Haste, +629 Vers }
Local Shoulders Crashing Oceantide Mantle
ilevel: 855, stats: { 251 Armor, +1019 AgiInt, +1529 Sta, +584 Crit, +413 Haste, +427 Leech }
Local Chest Grove Keeper's Robe
ilevel: 865, stats: { 346 Armor, +2237 Sta, +1491 AgiInt, +956 Crit, +424 Haste }
Local Waist Sinister Ashfall Cord
ilevel: 855, stats: { 188 Armor, +1019 AgiInt, +1529 Sta, +712 Crit, +285 Mastery }
Local Legs Felbat Leather Leggings
ilevel: 855, stats: { 293 Armor, +1359 AgiInt, +2039 Sta, +807 Crit, +523 Vers }
Local Feet Tunnel Trudger Footguards
ilevel: 845, stats: { 223 Armor, +929 AgiInt, +1393 Sta, +686 Crit, +274 Haste }
Local Wrists Dragonspur Wristguards
ilevel: 850, stats: { 144 Armor, +1094 Sta, +729 AgiInt, +509 Crit, +225 Haste }
Local Hands Gloves of Vile Defiance
ilevel: 860, stats: { 213 Armor, +1068 AgiInt, +1601 Sta, +726 Haste, +290 Mastery }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 855, stats: { +1147 Sta, +1283 Crit, +588 Haste }
Local Finger2 Dingy Wedding Band
ilevel: 865, stats: { +1258 Sta, +1054 Haste, +887 Mastery }, gems: { +150 Vers }, enchant: { +200 Vers }
Local Trinket1 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }
Local Trinket2 Leycoral Shard
ilevel: 850, stats: { +1233 Int, +932 Haste }
Local Back Ragged Azsharan Sail Fragment
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +446 Mastery, +316 Haste }, enchant: { +200 Agi }
Local Main Hand Scythe of Elune
ilevel: 879, weapon: { 4397 - 6597, 3.6 }, stats: { +1700 Int, +2550 Sta, +740 Crit, +711 Mastery, +9272 Int }, relics: { +43 ilevels, +46 ilevels, +40 ilevels }

Talents

Level
15 Force of Nature (Balance Druid) Warrior of Elune (Balance Druid) Starlord (Balance Druid)
30 Renewal Displacer Beast Wild Charge
45 Feral Affinity (Balance Druid) Guardian Affinity (Balance Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Balance Druid) Incarnation: Chosen of Elune Stellar Flare (Balance Druid)
90 Shooting Stars (Balance Druid) Astral Communion (Balance Druid) Blessing of the Ancients (Balance Druid)
100 Fury of Elune (Balance Druid) Stellar Drift (Balance Druid) Nature's Balance (Balance Druid)

Profile

druid="Madarii"
origin="https://us.api.battle.net/wow/character/thrall/Madarii/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/13/133790221-avatar.jpg"
level=110
race=tauren
role=spell
position=back
professions=alchemy=800/herbalism=815
talents=3122213
artifact=59:0:0:0:0:1035:3:1036:3:1039:3:1040:3:1042:3:1044:1:1045:1:1046:1:1047:1:1049:1:1294:1
spec=balance

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/moonkin_form
actions.precombat+=/blessing_of_elune
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/new_moon

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/blessing_of_elune,if=active_enemies<=2&talent.blessing_of_the_ancients.enabled&buff.blessing_of_elune.down
actions+=/blessing_of_elune,if=active_enemies>=3&talent.blessing_of_the_ancients.enabled&buff.blessing_of_anshe.down
actions+=/blood_fury,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/berserking,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/arcane_torrent,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=fury_of_elune,if=talent.fury_of_elune.enabled&cooldown.fury_of_elue.remains<target.time_to_die
actions+=/call_action_list,name=ed,if=equipped.the_emerald_dreamcatcher
actions+=/new_moon,if=(charges=2&recharge_time<5)|charges=3
actions+=/half_moon,if=(charges=2&recharge_time<5)|charges=3|(target.time_to_die<15&charges=2)
actions+=/full_moon,if=(charges=2&recharge_time<5)|charges=3|target.time_to_die<15
actions+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions+=/astral_communion,if=astral_power.deficit>=75
actions+=/incarnation,if=astral_power>=40
actions+=/celestial_alignment,if=astral_power>=40
actions+=/starfall,if=buff.oneths_overconfidence.up
actions+=/solar_wrath,if=buff.solar_empowerment.stack=3
actions+=/lunar_strike,if=buff.lunar_empowerment.stack=3
actions+=/call_action_list,name=celestial_alignment_phase,if=buff.celestial_alignment.up|buff.incarnation.up
actions+=/call_action_list,name=single_target

actions.celestial_alignment_phase=starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.celestial_alignment_phase+=/starsurge,if=active_enemies<=2
actions.celestial_alignment_phase+=/warrior_of_elune
actions.celestial_alignment_phase+=/lunar_strike,if=buff.warrior_of_elune.up
actions.celestial_alignment_phase+=/solar_wrath,if=buff.solar_empowerment.up
actions.celestial_alignment_phase+=/lunar_strike,if=buff.lunar_empowerment.up
actions.celestial_alignment_phase+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.celestial_alignment_phase+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.celestial_alignment_phase+=/solar_wrath

actions.ed=astral_communion,if=astral_power.deficit>=75&buff.the_emerald_dreamcatcher.up
actions.ed+=/incarnation,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/celestial_alignment,if=astral_power>=85&!buff.the_emerald_dreamcatcher.up
actions.ed+=/starsurge,if=(buff.the_emerald_dreamcatcher.up&buff.the_emerald_dreamcatcher.remains<gcd.max)|astral_power>=90|((buff.celestial_alignment.up|buff.incarnation.up)&astral_power>=85)
actions.ed+=/stellar_flare,cycle_targets=1,max_cycle_targets=4,if=active_enemies<4&remains<7.2&astral_power>=15
actions.ed+=/moonfire,if=(talent.natures_balance.enabled&remains<3)|(remains<6.6&!talent.natures_balance.enabled)
actions.ed+=/sunfire,if=(talent.natures_balance.enabled&remains<3)|(remains<5.4&!talent.natures_balance.enabled)
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=12&dot.sunfire.remains<5.4&dot.moonfire.remains>6.6
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up&buff.the_emerald_dreamcatcher.remains>execute_time&astral_power>=8&(!(buff.celestial_alignment.up|buff.incarnation.up)|(buff.celestial_alignment.up|buff.incarnation.up)&astral_power<=77)
actions.ed+=/new_moon,if=astral_power<=90
actions.ed+=/half_moon,if=astral_power<=80
actions.ed+=/full_moon,if=astral_power<=60
actions.ed+=/solar_wrath,if=buff.solar_empowerment.up
actions.ed+=/lunar_strike,if=buff.lunar_empowerment.up
actions.ed+=/solar_wrath

actions.fury_of_elune=incarnation,if=astral_power>=95&cooldown.fury_of_elune.remains<=gcd
actions.fury_of_elune+=/fury_of_elune,if=astral_power>=95
actions.fury_of_elune+=/new_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=90))
actions.fury_of_elune+=/half_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=80))
actions.fury_of_elune+=/full_moon,if=((charges=2&recharge_time<5)|charges=3)&&(buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>gcd*3&astral_power<=60))
actions.fury_of_elune+=/astral_communion,if=buff.fury_of_elune_up.up&astral_power<=25
actions.fury_of_elune+=/warrior_of_elune,if=buff.fury_of_elune_up.up|(cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.up)
actions.fury_of_elune+=/lunar_strike,if=buff.warrior_of_elune.up&(astral_power<=90|(astral_power<=85&buff.incarnation.up))
actions.fury_of_elune+=/new_moon,if=astral_power<=90&buff.fury_of_elune_up.up
actions.fury_of_elune+=/half_moon,if=astral_power<=80&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/full_moon,if=astral_power<=60&buff.fury_of_elune_up.up&astral_power>cast_time*12
actions.fury_of_elune+=/moonfire,if=buff.fury_of_elune_up.down&remains<=6.6
actions.fury_of_elune+=/sunfire,if=buff.fury_of_elune_up.down&remains<5.4
actions.fury_of_elune+=/stellar_flare,if=remains<7.2&active_enemies=1
actions.fury_of_elune+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>10
actions.fury_of_elune+=/starsurge,if=active_enemies<=2&buff.fury_of_elune_up.down&cooldown.fury_of_elune.remains>7
actions.fury_of_elune+=/starsurge,if=buff.fury_of_elune_up.down&((astral_power>=92&cooldown.fury_of_elune.remains>gcd*3)|(cooldown.warrior_of_elune.remains<=5&cooldown.fury_of_elune.remains>=35&buff.lunar_empowerment.stack<2))
actions.fury_of_elune+=/solar_wrath,if=buff.solar_empowerment.up
actions.fury_of_elune+=/lunar_strike,if=buff.lunar_empowerment.stack=3|(buff.lunar_empowerment.remains<5&buff.lunar_empowerment.up)|active_enemies>=2
actions.fury_of_elune+=/solar_wrath

actions.single_target=new_moon,if=astral_power<=90
actions.single_target+=/half_moon,if=astral_power<=80
actions.single_target+=/full_moon,if=astral_power<=60
actions.single_target+=/starfall,if=(active_enemies>=2&talent.stellar_flare.enabled|active_enemies>=3)&((talent.fury_of_elune.enabled&cooldown.fury_of_elune.remains>12&buff.fury_of_elune_up.down)|!talent.fury_of_elune.enabled)
actions.single_target+=/starsurge,if=active_enemies<=2
actions.single_target+=/warrior_of_elune
actions.single_target+=/lunar_strike,if=buff.warrior_of_elune.up
actions.single_target+=/solar_wrath,if=buff.solar_empowerment.up
actions.single_target+=/lunar_strike,if=buff.lunar_empowerment.up
actions.single_target+=/solar_wrath,if=talent.natures_balance.enabled&dot.sunfire_dmg.remains<5&cast_time<dot.sunfire_dmg.remains
actions.single_target+=/lunar_strike,if=(talent.natures_balance.enabled&dot.moonfire_dmg.remains<5&cast_time<dot.moonfire_dmg.remains)|active_enemies>=2
actions.single_target+=/solar_wrath

head=magicwarped_hood,id=141453,bonus_id=1472
neck=chain_of_scorched_bones,id=134529,bonus_id=1727/1502/3336
shoulders=crashing_oceantide_mantle,id=137364,bonus_id=1727/41/1507/3337
back=ragged_azsharan_sail_fragment,id=141539,bonus_id=3466/1472,enchant=200agi
chest=grove_keepers_robe,id=139207,bonus_id=1805/1487
wrists=dragonspur_wristguards,id=138219,bonus_id=1807/1808/1472
hands=gloves_of_vile_defiance,id=137320,bonus_id=3413/1512/3336
waist=sinister_ashfall_cord,id=134455,bonus_id=1727/1507/3337
legs=felbat_leather_leggings,id=134370,bonus_id=3411/1517/3336
feet=tunnel_trudger_footguards,id=137397,bonus_id=1727/1497/3336
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1477/3336
finger2=dingy_wedding_band,id=134534,bonus_id=3414/1808/1517/3336,gems=150vers,enchant=200vers
trinket1=twisting_wind,id=139323,bonus_id=1807/1472
trinket2=leycoral_shard,id=134248,bonus_id=3397/604/1512/3337
main_hand=scythe_of_elune,id=128858,bonus_id=722,gem_id=141266/142309/137303/0,relic_id=3432:1512:3337/3453:1472/1727:1492:1813/0

# Gear Summary
# gear_ilvl=856.93
# gear_agility=200
# gear_stamina=20808
# gear_intellect=23277
# gear_crit_rating=6693
# gear_haste_rating=6158
# gear_mastery_rating=3558
# gear_versatility_rating=1502
# gear_leech_rating=427
# gear_armor=2069

Oinkie

Oinkie : 282597 dps, 177680 dps to main target

  • Race: Tauren
  • Class: Druid
  • Spec: Feral
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
282597.3 282597.3 232.3 / 0.082% 46739.8 / 16.5% 19217.2
RPS Out RPS In Primary Resource Waiting APM Active Skill
14.7 14.7 Energy 18.12% 43.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Oinkie/advanced
Talents
  • 15: Lunar Inspiration (Feral Druid)
  • 30: Wild Charge
  • 45: Balance Affinity
  • 60: Mighty Bash
  • 75: Savage Roar (Feral Druid)
  • 90: Jagged Wounds (Feral Druid)
  • 100: Bloodtalons (Feral Druid)
  • Talent Calculator
Artifact
Professions
  • herbalism: 815
  • inscription: 718
Scale Factors for Oinkie Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 9.45 7.30 6.77 6.18 4.04
Normalized 1.00 0.77 0.72 0.65 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.29 0.29 0.29 0.29 0.29
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.45, CritRating=6.18, HasteRating=7.30, MasteryRating=4.04, Versatility=6.77 )

Scale Factors for other metrics

Scale Factors for Oinkie Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 9.45 7.30 6.77 6.18 4.04
Normalized 1.00 0.77 0.72 0.65 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.29 0.29 0.29 0.29 0.29
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.45, CritRating=6.18, HasteRating=7.30, MasteryRating=4.04, Versatility=6.77 )
Scale Factors for Oinkie Priority Target Damage Per Second
Agi Haste Vers Crit Mastery
Scale Factors 5.87 4.53 4.16 3.82 2.75
Normalized 1.00 0.77 0.71 0.65 0.47
Scale Deltas 1138 1138 1138 1138 1138
Error 0.30 0.29 0.29 0.29 0.29
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=5.87, CritRating=3.82, HasteRating=4.53, MasteryRating=2.75, Versatility=4.16 )
Scale Factors for Oinkie Damage Per Second (Effective)
Agi Haste Vers Crit Mastery
Scale Factors 9.45 7.30 6.77 6.18 4.04
Normalized 1.00 0.77 0.72 0.65 0.43
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Haste > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Oinkie": Agility=9.45, CritRating=6.18, HasteRating=7.30, MasteryRating=4.04, Versatility=6.77 )
Scale Factors for Oinkie Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for Oinkie Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )
Scale Factors for OinkieTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Oinkie": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Oinkie 282597
Ashamane's Rip 8595 3.1% 5.7 58.66sec 615292 0 Periodic 44.6 55418 113071 79264 41.4% 14.3%

Stats details: ashamanes_rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.74 0.00 44.59 44.59 0.0000 1.2802 3534527.49 3534527.49 0.00 61914.75 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.1 58.64% 55418.07 38 70203 54408.71 0 70203 1449121 1449121 0.00
crit 18.4 41.36% 113070.90 78 143213 110777.04 0 143213 2085407 2085407 0.00
 
 

Action details: ashamanes_rip

Static Values
  • id:210705
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210705
  • name:Ashamane's Rip
  • school:shadow
  • tooltip:Suffering $w1 Shadow damage every $t1 sec.
  • description:{$@spelldesc210702=Your combo point generators against targets bleeding from your Rip have a {$h=10}% chance to awaken the Spirit of Ashamane, which inflicts a Shadowy duplicate of that Rip on the target.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:24.00
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
cat_melee 29504 10.5% 422.5 0.95sec 27993 33138 Direct 422.5 19573 39935 27993 41.3%  

Stats details: cat_melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 422.52 422.52 0.00 0.00 0.8447 0.0000 11827385.97 16923204.44 30.11 33138.29 33138.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 247.81 58.65% 19573.36 14272 26974 19558.26 18622 20353 4850420 6940152 30.11
crit 174.71 41.35% 39935.22 29115 55028 39904.71 37526 41792 6976966 9983052 30.12
 
 

Action details: cat_melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Ferocious Bite 4311 1.6% 7.5 56.71sec 234123 233092 Direct 7.5 153507 348125 234130 41.4%  

Stats details: ferocious_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.54 7.54 0.00 0.00 1.0045 0.0000 1765675.56 2492619.28 29.16 233092.48 233092.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.42 58.57% 153506.50 14456 246802 150079.48 0 246802 678046 957135 28.69
crit 3.12 41.43% 348125.02 32876 557377 330683.40 0 557377 1087629 1535484 27.90
 
 

Action details: ferocious_bite

Static Values
  • id:22568
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Spelldata
  • id:22568
  • name:Ferocious Bite
  • school:physical
  • tooltip:
  • description:Finishing move that causes Physical damage per combo point and consumes up to 25 additional Energy to increase damage by up to 100%. {$?s202031=false}[]?s231056[When used on targets below 25% health, ][]{$?s231056=true}[Ferocious Bite will also refresh the duration of your Rip on your target. ][] 1 point : ${$m1*1/5} damage 2 points: ${$m1*2/5} damage 3 points: ${$m1*3/5} damage 4 points: ${$m1*4/5} damage 5 points: ${$m1*5/5} damage
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.745000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Moonfire (lunar_inspiration) 17707 6.3% 17.6 23.49sec 407603 405793 Direct 17.6 39502 80578 56555 41.5%  
Periodic 152.0 28366 57831 40555 41.4% 59.8%

Stats details: lunar_inspiration

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 17.56 17.56 152.01 152.01 1.0045 1.5748 7157774.88 7157774.88 0.00 27849.42 405792.56
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 10.27 58.49% 39501.54 28475 51883 39461.93 30077 48299 405700 405700 0.00
crit 7.29 41.51% 80578.43 58088 105842 80501.16 0 105842 587427 587427 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.1 58.63% 28365.83 859 40354 28285.43 24506 31007 2528168 2528168 0.00
crit 62.9 41.37% 57830.97 1753 82322 57654.48 48808 64358 3636480 3636480 0.00
 
 

Action details: lunar_inspiration

Static Values
  • id:155625
  • school:arcane
  • resource:energy
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
Spelldata
  • id:155625
  • name:Moonfire
  • school:arcane
  • tooltip:Suffering $w1 Arcane damage every $t1 seconds.
  • description:A quick beam of lunar light burns the enemy for {$s2=1} Arcane damage and then an additional $o1 Arcane damage over {$d=14 seconds}. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.875000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Potion of the Old War 14796 5.2% 23.7 14.35sec 246795 0 Direct 23.7 172698 352173 246793 41.3%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.70 23.70 0.00 0.00 0.0000 0.0000 5849425.79 8599209.99 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.92 58.71% 172698.42 119382 205933 172668.56 134304 199218 2403306 3533088 31.98
crit 9.79 41.29% 352172.91 243539 420104 352114.59 0 420104 3446119 5066122 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Rake 25602 9.2% 19.1 22.46sec 544004 541590 Direct 19.1 64340 131360 92014 41.3%  
Periodic 110.9 54350 110723 77655 41.3% 46.5%

Stats details: rake

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.05 19.05 110.89 110.89 1.0045 1.6799 10363869.36 10363869.36 0.00 50453.32 541590.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.18 58.70% 64339.71 46397 87301 64414.17 51616 78010 719567 719567 0.00
crit 7.87 41.30% 131359.76 94649 178094 131479.94 0 178094 1033437 1033437 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.0 58.66% 54350.23 92 109704 54465.03 43874 65657 3535209 3535209 0.00
crit 45.8 41.34% 110723.22 188 223797 110969.16 86287 141387 5075656 5075656 0.00
 
 

Action details: rake

Static Values
  • id:1822
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.prowl.up
Spelldata
  • id:1822
  • name:Rake
  • school:physical
  • tooltip:
  • description:Rake the target for {$s1=1} Bleed damage and an additional $155722o1 Bleed damage over {$155722d=15 seconds}.{$?s48484=false}[ Reduces the target's movement speed by {$58180s1=50}% for {$58180d=12 seconds}.][]$?a231052[ While stealthed, Rake will also stun the target for {$163505d=4 seconds}, and deal {$s4=100}% increased damage.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.912000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Rip 40701 14.5% 14.7 23.49sec 1111291 1106348 Periodic 215.3 53191 108519 76037 41.3% 69.5%

Stats details: rip

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.73 0.00 215.30 215.30 1.0045 1.2922 16370625.67 16370625.67 0.00 55871.49 1106347.62
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 126.4 58.71% 53190.52 38 70203 53118.63 47819 58439 6723051 6723051 0.00
crit 88.9 41.29% 108518.92 78 143213 108374.93 94821 119744 9647575 9647575 0.00
 
 

Action details: rip

Static Values
  • id:1079
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Spelldata
  • id:1079
  • name:Rip
  • school:physical
  • tooltip:Bleeding for $w1 damage every $t1 sec.
  • description:Finishing move that causes Bleed damage over {$d=24 seconds}. Damage increases per combo point: 1 point : ${$floor(1*$<rip>*12)} damage 2 points: ${$floor(2*$<rip>*12)} damage 3 points: ${$floor(3*$<rip>*12)} damage 4 points: ${$floor(4*$<rip>*12)} damage 5 points: ${$floor(5*$<rip>*12)} damage
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.160000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.08
  • base_tick_time:1.34
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shred 20107 7.2% 50.5 7.96sec 161717 160995 Direct 50.5 101941 208175 161716 56.3%  

Stats details: shred

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 50.50 50.50 0.00 0.00 1.0045 0.0000 8167441.07 11623363.73 29.73 160995.07 160995.07
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.09 43.73% 101940.63 59493 129355 101814.56 85069 113319 2251484 3204249 29.75
crit 28.42 56.27% 208175.42 121366 263885 207916.62 181820 233466 5915957 8419115 29.75
 
 

Action details: shred

Static Values
  • id:5221
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.15
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)
Spelldata
  • id:5221
  • name:Shred
  • school:physical
  • tooltip:
  • description:Shred the target, causing ${$sw1*$<mult>} Physical damage to the target.$?a231063[ Deals {$s5=20}% increased damage against bleeding targets.][]$?a231057[ While stealthed, Shred deals $m4% increased damage, and has double the chance to critically strike.][] |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.95
 
Swipe (_cat) 75268 26.3% 60.9 4.79sec 487649 485470 Direct 365.7 56814 115909 81275 41.4%  

Stats details: swipe_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 60.95 365.67 0.00 0.00 1.0045 0.0000 29719964.71 43432857.44 31.57 485469.62 485469.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 214.31 58.61% 56814.25 37218 80923 56762.27 52013 62449 12175795 17793914 31.57
crit 151.36 41.39% 115909.10 75925 165083 115807.65 105652 128241 17544170 25638943 31.57
 
 

Action details: swipe_cat

Static Values
  • id:106785
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:45.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.swipe_cat>=8
Spelldata
  • id:106785
  • name:Swipe
  • school:physical
  • tooltip:
  • description:Swipe nearby enemies, inflicting $sw3 Physical damage.$?a231283[ Deals {$s2=20}% increased damage against bleeding targets.][] |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.00
 
Thrash (_cat) 38346 (46007) 13.4% (16.1%) 22.5 13.18sec 806666 803066 Direct 135.1 21222 43291 30362 41.4%  
Periodic 551.2 13996 28562 20025 41.4% 258.2%

Stats details: thrash_cat

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 22.52 135.10 551.23 551.23 1.0045 1.8757 15140202.14 15140202.14 0.00 17191.10 803066.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 79.15 58.58% 21222.26 17239 29737 21212.07 19342 22931 1679683 1679683 0.00
crit 55.95 41.42% 43291.05 35168 60664 43269.89 39373 47100 2422314 2422314 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 323.1 58.61% 13996.41 14 21180 13998.48 12533 15696 4522048 4522048 0.00
crit 228.1 41.39% 28562.50 29 43206 28565.91 25394 32321 6516158 6516158 0.00
 
 

Action details: thrash_cat

Static Values
  • id:106830
  • school:physical
  • resource:energy
  • range:8.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:remains<=duration*0.3&spell_targets.thrash_cat>=5
Spelldata
  • id:106830
  • name:Thrash
  • school:physical
  • tooltip:Bleeding for $w2 damage every $t2 sec.
  • description:Strikes all nearby enemies, dealing $m1 Bleed damage and an additional $o2 Bleed damage over {$d=15 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.410000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.292000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:10.05
  • base_tick_time:2.01
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Shadow Thrash 7661 2.7% 5.6 44.42sec 536141 0 Periodic 96.5 21908 44674 31333 41.4% 1.9%

Stats details: shadow_thrash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.64 0.00 16.92 96.50 0.0000 0.4463 3023549.02 3023549.02 0.00 400417.03 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 56.5 58.60% 21907.99 40 46119 21876.67 0 38432 1238871 1238871 0.00
crit 40.0 41.40% 44673.77 82 94082 44619.15 0 78402 1784678 1784678 0.00
 
 

Action details: shadow_thrash

Static Values
  • id:210686
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210686
  • name:Shadow Thrash
  • school:physical
  • tooltip:
  • description:{$@spelldesc210676=Thrash has a {$h=25}% chance to release part of Ashamane's soul, causing all nearby enemies to take ${2*{$210687s1=1}} Shadow damage over {$210686d=2 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:1.34
  • base_tick_time:0.67
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Oinkie
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
Berserk 2.7 182.06sec

Stats details: berserk

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.71 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserk

Static Values
  • id:106951
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.tigers_fury.up
Spelldata
  • id:106951
  • name:Berserk
  • school:physical
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
 
Cat Form 1.0 0.00sec

Stats details: cat_form

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: cat_form

Static Values
  • id:768
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:1.5000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:768
  • name:Cat Form
  • school:physical
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
 
Dash 2.4 188.51sec

Stats details: dash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: dash

Static Values
  • id:1850
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.cat_form.up
Spelldata
  • id:1850
  • name:Dash
  • school:physical
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Oinkie
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Savage Roar 14.4 28.70sec

Stats details: savage_roar

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.41 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: savage_roar

Static Values
  • id:52610
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
Spelldata
  • id:52610
  • name:Savage Roar
  • school:physical
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
 
Skull Bash 13.5 30.35sec

Stats details: skull_bash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.47 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: skull_bash

Static Values
  • id:106839
  • school:physical
  • resource:none
  • range:13.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:106839
  • name:Skull Bash
  • school:physical
  • tooltip:
  • description:You charge and bash the target's skull, interrupting spellcasting and preventing any spell in that school from being cast for {$93985d=4 seconds}.
 
Tiger's Fury 13.6 30.33sec

Stats details: tigers_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: tigers_fury

Static Values
  • id:5217
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
Spelldata
  • id:5217
  • name:Tiger's Fury
  • school:physical
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
 
Wild Charge 16.1 24.26sec

Stats details: wild_charge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wild_charge

Static Values
  • id:102401
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:102401
  • name:Wild Charge
  • school:physical
  • tooltip:Flying to an ally's position.
  • description:Fly to a nearby ally's position.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Ashamane's Energy 13.6 0.0 30.3sec 30.3sec 10.14% 10.14% 40.6(40.6) 13.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_ashamanes_energy
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:20.00

Stack Uptimes

  • ashamanes_energy_1:10.14%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210583
  • name:Ashamane's Energy
  • tooltip:Gaining $w1 energy every $t sec.
  • description:{$@spelldesc210579=Tiger's Fury generates an additional {$s1=5} energy every $210583t sec for {$210583d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Berserk 2.7 0.0 182.0sec 182.0sec 9.91% 18.68% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_berserk
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.50

Stack Uptimes

  • berserk_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:106951
  • name:Berserk
  • tooltip:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50}.
  • description:Reduces the cost of all Cat Form abilities by {$s1=50}% and increases maximum Energy by {$s3=50} for {$d=15 seconds}. Requires Cat Form.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 20.14% 0.0(0.0) 1.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 421.5 0.0sec 0.9sec 99.78% 99.78% 402.5(402.5) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:72.98

Stack Uptimes

  • chaotic_energy_1:0.03%
  • chaotic_energy_2:0.17%
  • chaotic_energy_3:0.17%
  • chaotic_energy_4:0.17%
  • chaotic_energy_5:0.17%
  • chaotic_energy_6:0.17%
  • chaotic_energy_7:0.17%
  • chaotic_energy_8:0.17%
  • chaotic_energy_9:0.17%
  • chaotic_energy_10:0.17%
  • chaotic_energy_11:0.17%
  • chaotic_energy_12:0.17%
  • chaotic_energy_13:0.17%
  • chaotic_energy_14:0.17%
  • chaotic_energy_15:0.17%
  • chaotic_energy_16:0.17%
  • chaotic_energy_17:0.17%
  • chaotic_energy_18:0.31%
  • chaotic_energy_19:0.17%
  • chaotic_energy_20:96.56%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Clearcasting 36.6 0.5 10.8sec 10.6sec 3.65% 17.55% 0.5(0.5) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_clearcasting
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • clearcasting_1:3.65%

Trigger Attempt Success

  • trigger_pct:8.77%

Spelldata details

  • id:135700
  • name:Clearcasting
  • tooltip:Cat Form abilities have {$s1=100}% reduced Energy cost.
  • description:{$@spelldesc16864=Your auto attacks have a chance to cause a Clearcasting state, making your next Cat Form ability cost no Energy.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Dash 2.4 0.0 188.5sec 188.5sec 8.75% 10.85% 0.0(0.0) 2.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_dash
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.70

Stack Uptimes

  • dash_1:8.75%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1850
  • name:Dash
  • tooltip:Increased movement speed by {$s1=70}% while in Cat Form.
  • description:Activates Cat Form and increases movement speed by {$s1=70}% while in Cat Form for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Feral Instinct 2.7 0.0 182.0sec 182.0sec 9.91% 13.03% 0.0(0.0) 2.6

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_feral_instinct
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • feral_instinct_1:9.91%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210649
  • name:Feral Instinct
  • tooltip:Damage dealt increased by $w1%.
  • description:{$@spelldesc210631={$?s102543=false}[Incarnation: King of the Jungle][Berserk] increases all damage you deal by {$s1=5}% for {$210649d=15 seconds}.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 290.2sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Predatory Swiftness 15.7 19.8 25.1sec 11.3sec 82.59% 82.59% 19.8(19.8) 14.8

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_predatory_swiftness
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • predatory_swiftness_1:82.59%

Trigger Attempt Success

  • trigger_pct:96.74%

Spelldata details

  • id:69369
  • name:Predatory Swiftness
  • tooltip:Your next Entangling Roots, Regrowth, or Rebirth will be instant, free, and castable in all forms.
  • description:{$@spelldesc16974=Your finishing moves have a {$s3=20}% chance per combo point to make your next Regrowth, Entangling Roots, or Rebirth instant, free, and castable in all forms.}
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Protection of Ashamane 1.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_protection_of_ashamane
  • max_stacks:1
  • duration:5.00
  • cooldown:30.00
  • default_chance:100.00%
  • default_value:1.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210655
  • name:Protection of Ashamane
  • tooltip:Chance to dodge attacks increased by $w1%. Armor increased by {$s2=100}%.
  • description:{$@spelldesc210650=When you shapeshift out of Cat Form, you gain {$210655s1=100}% increased dodge chance and armor for {$210655d=5 seconds} or until you shapeshift back into Cat Form. Can only occur once every {$214274d=30 seconds}.}
  • max_stacks:0
  • duration:5.00
  • cooldown:0.00
  • default_chance:0.00%
Prowl 1.0 0.0 0.0sec 0.0sec 0.00% 1.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_prowl
  • max_stacks:1
  • duration:0.00
  • cooldown:10.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5215
  • name:Prowl
  • tooltip:Stealthed.
  • description:Activates Cat Form and places you into stealth until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
raid_movement 33.8 1.0 11.6sec 11.3sec 6.60% 6.60% 1.0(1.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:6.60%

Trigger Attempt Success

  • trigger_pct:100.00%
Savage Roar 11.4 3.0 32.1sec 28.7sec 81.08% 80.23% 162.9(162.9) 10.4

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_savage_roar
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • savage_roar_1:81.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:52610
  • name:Savage Roar
  • tooltip:Damage done increased by $w2%.
  • description:Finishing move that grants {$62071s1=25}% increased damage to your Cat Form attacks for their full duration. Lasts longer per combo point: 1 point : 8 seconds 2 points: 12 seconds 3 points: 16 seconds 4 points: 20 seconds 5 points: 24 seconds
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Scent of Blood 22.5 0.0 13.2sec 13.2sec 22.82% 54.24% 0.0(0.0) 22.5

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_scent_of_blood
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-2.00

Stack Uptimes

  • scent_of_blood_1:22.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210664
  • name:Scent of Blood
  • tooltip:Energy cost of {$?s202028=false}[Brutal Slash][Swipe] reduced by $w1.
  • description:{$@spelldesc210663=Each target hit by Thrash reduces the cost of {$?s202028=false}[Brutal Slash][Swipe] by {$s1=2} Energy for the next {$210664d=4 seconds}.}
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Tiger's Fury 13.6 0.0 30.3sec 30.3sec 26.89% 31.07% 0.0(0.0) 13.3

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_tigers_fury
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.15

Stack Uptimes

  • tigers_fury_1:26.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:5217
  • name:Tiger's Fury
  • tooltip:Attacks deal {$s1=15}% additional damage for their full duration.
  • description:Instantly restores {$s2=20} Energy, and increases the damage of all your attacks by {$s1=15}% for their full duration. Lasts {$d=8 seconds}.
  • max_stacks:0
  • duration:8.00
  • cooldown:30.00
  • default_chance:0.00%
wild_charge_movement 16.1 0.0 24.3sec 24.3sec 0.99% 14.46% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_wild_charge_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • wild_charge_movement_1:0.99%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Cat Form

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_cat_form
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • cat_form_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:768
  • name:Cat Form
  • tooltip:Immune to Polymorph effects. Movement speed increased by {$113636s1=30}% and falling damage reduced.
  • description:Shapeshift into Cat Form, increasing movement speed by {$113636s1=30}%, granting protection from Polymorph effects, and reducing falling damage. The act of shapeshifting frees you from movement impairing effects.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
Defiled Augmentation

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Oinkie
ferocious_bite Energy 15.1 232.8 15.4 30.9 7584.5
ferocious_bite Combo Points 7.5 31.9 4.2 4.2 55376.7
lunar_inspiration Energy 17.6 411.7 23.4 23.4 17385.3
rake Energy 19.1 531.1 27.9 27.9 19515.8
rip Energy 14.7 326.6 22.2 22.2 50124.1
rip Combo Points 14.7 73.7 5.0 5.0 222255.1
savage_roar Energy 14.4 421.6 29.2 29.3 0.0
savage_roar Combo Points 14.4 72.1 5.0 5.0 0.0
shred Energy 50.5 1296.3 25.7 25.7 6300.4
swipe_cat Energy 60.9 1770.9 29.1 29.1 16782.5
thrash_cat Energy 22.5 885.0 39.3 39.3 20524.6
Resource Gains Type Count Total Average Overflow
rake Combo Points 19.05 18.99 (10.51%) 1.00 0.06 0.33%
tigers_fury Energy 13.58 271.56 (3.77%) 20.00 0.00 0.00%
swipe_cat Combo Points 60.95 0.61 (0.34%) 0.01 0.00 0.33%
lunar_inspiration Combo Points 17.56 17.51 (9.69%) 1.00 0.05 0.27%
shred Combo Points 50.51 50.47 (27.93%) 1.00 0.03 0.06%
energy_regen Energy 1535.14 4725.58 (65.55%) 3.08 5.13 0.11%
clearcasting Energy 36.49 1403.44 (19.47%) 38.46 0.00 0.00%
ashamanes_energy Energy 40.55 808.73 (11.22%) 19.94 2.36 0.29%
primal_fury Combo Points 102.05 93.14 (51.54%) 0.91 8.91 8.73%
Resource RPS-Gain RPS-Loss
Energy 14.50 14.67
Combo Points 0.45 0.44
Combat End Resource Mean Min Max
Mana 704000.00 704000.00 704000.00
Rage 0.00 0.00 0.00
Energy 28.55 0.00 100.00
Astral Power 0.00 0.00 0.00
Combo Points 3.11 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 0.0%

Procs

Count Interval
clearcasting 37.1 10.6sec
clearcasting_wasted 0.5 127.7sec
primal_fury 102.1 3.9sec

Statistics & Data Analysis

Fight Length
Sample Data Oinkie Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Oinkie Damage Per Second
Count 9999
Mean 282597.28
Minimum 245069.13
Maximum 340419.55
Spread ( max - min ) 95350.42
Range [ ( max - min ) / 2 * 100% ] 16.87%
Standard Deviation 11852.9499
5th Percentile 264108.53
95th Percentile 303212.91
( 95th Percentile - 5th Percentile ) 39104.39
Mean Distribution
Standard Deviation 118.5354
95.00% Confidence Intervall ( 282364.95 - 282829.60 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 67
0.1% Error 6757
0.1 Scale Factor Error with Delta=300 1199324
0.05 Scale Factor Error with Delta=300 4797296
0.01 Scale Factor Error with Delta=300 119932412
Priority Target DPS
Sample Data Oinkie Priority Target Damage Per Second
Count 9999
Mean 177680.27
Minimum 130414.67
Maximum 215059.21
Spread ( max - min ) 84644.54
Range [ ( max - min ) / 2 * 100% ] 23.82%
Standard Deviation 11907.8006
5th Percentile 156115.31
95th Percentile 195417.98
( 95th Percentile - 5th Percentile ) 39302.68
Mean Distribution
Standard Deviation 119.0840
95.00% Confidence Intervall ( 177446.87 - 177913.67 )
Normalized 95.00% Confidence Intervall ( 99.87% - 100.13% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 172
0.1% Error 17253
0.1 Scale Factor Error with Delta=300 1210449
0.05 Scale Factor Error with Delta=300 4841799
0.01 Scale Factor Error with Delta=300 121044977
DPS(e)
Sample Data Oinkie Damage Per Second (Effective)
Count 9999
Mean 282597.28
Minimum 245069.13
Maximum 340419.55
Spread ( max - min ) 95350.42
Range [ ( max - min ) / 2 * 100% ] 16.87%
Damage
Sample Data Oinkie Damage
Count 9999
Mean 112920441.67
Minimum 81564118.44
Maximum 147787036.46
Spread ( max - min ) 66222918.02
Range [ ( max - min ) / 2 * 100% ] 29.32%
DTPS
Sample Data Oinkie Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Oinkie Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Oinkie Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Oinkie Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Oinkie Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Oinkie Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data OinkieTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Oinkie Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=nightborne_delicacy_platter
2 0.00 augmentation,type=defiled
3 0.00 cat_form
4 0.00 prowl
5 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
6 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
0.00 dash,if=!buff.cat_form.up
0.00 cat_form
7 16.06 wild_charge
0.00 displacer_beast,if=movement.distance>10
8 2.38 dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
9 1.00 rake,if=buff.prowl.up
A 34.73 auto_attack
B 13.47 skull_bash
C 2.71 berserk,if=buff.tigers_fury.up
0.00 incarnation,if=cooldown.tigers_fury.remains<gcd
D 1.00 potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
E 13.64 tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
0.00 incarnation,if=energy.time_to_max>1&energy>=35
F 3.77 ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
Keep Rip from falling off during execute range.
G 0.00 call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
H 0.00 call_action_list,name=finisher
I 0.00 call_action_list,name=generator
actions.finisher
# count action,conditions
0.00 pool_resource,for_next=1
Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
J 11.42 savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
0.00 pool_resource,for_next=1
Thrash has higher priority than finishers at 5 targets
K 22.52 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
0.00 pool_resource,for_next=1
Replace Rip with Swipe at 8 targets
0.00 swipe_cat,if=spell_targets.swipe_cat>=8
L 14.73 rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Rip at 8 seconds or for a stronger Rip
M 3.00 savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
Refresh Savage Roar early with Jagged Wounds
N 0.04 swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
O 3.77 ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.generator
# count action,conditions
0.00 brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
Brutal Slash if there's adds up
0.00 ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
0.00 pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
Pool energy for Elune's Guidance when it's coming off cooldown.
0.00 elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
0.00 pool_resource,for_next=1
Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
0.00 thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
0.00 pool_resource,for_next=1
Use Swipe over Rake or Moonfire at 6 targets.
P 60.91 swipe_cat,if=spell_targets.swipe_cat>=6
0.00 pool_resource,for_next=1
Refresh Rake early with Bloodtalons
Q 18.05 rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
R 17.56 moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
0.00 pool_resource,for_next=1
0.00 thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
0.00 brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
Brutal Slash if you would cap out charges before the next adds spawn
0.00 swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
S 50.51 shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

Sample Sequence

0123469ARBSECJSSSSLSSQ7RAOSSSSLS8KAPPPKAPPEJPPKPBQRLASS7AKPJAEKPPPQRLABS7AKPPPJKAEPPPPPLQRSA7AKLBPPKEPPAPJPQRSLAKPPKBEPPPAJQRSS7AAKLPECKPPPPJABPQRSLSSS7AKLABPKEPPPPJP7RAQLBS8KAP7APKPJPEPPBKQARLS7AKBPPPPAJKPEPPPQLR7ASSBAKFPAKEPPPPJQFR7ASSMQFBRASEQOSRSS7AMQSFDRQ7AECSSOSRSBSMQSSOSS7ASOQRS

Sample Sequence Table

time name target resources buffs
Pre flask Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre food Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre augmentation Oinkie 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre cat_form Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre prowl Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 rake Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 65.0/100: 65% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points potion_of_the_old_war
0:01.005 lunar_inspiration Fluffy_Pillow 77.0/100: 77% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, chaotic_energy(2), potion_of_the_old_war
0:02.010 skull_bash Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, chaotic_energy(3), potion_of_the_old_war
0:02.010 shred Fluffy_Pillow 62.0/100: 62% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, chaotic_energy(3), potion_of_the_old_war
0:03.016 tigers_fury Fluffy_Pillow 37.0/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, chaotic_energy(5), potion_of_the_old_war
0:03.016 berserk Fluffy_Pillow 57.0/100: 57% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, ashamanes_energy, tigers_fury, chaotic_energy(5), potion_of_the_old_war
0:03.016 savage_roar Fluffy_Pillow 57.0/150: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, tigers_fury, chaotic_energy(5), potion_of_the_old_war
0:04.019 shred Fluffy_Pillow 72.0/150: 48% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(6), potion_of_the_old_war
0:05.023 shred Fluffy_Pillow 86.9/150: 58% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, clearcasting, feral_instinct, ashamanes_energy, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(8), potion_of_the_old_war
0:06.028 shred Fluffy_Pillow 121.9/150: 81% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(9), potion_of_the_old_war
0:07.032 shred Fluffy_Pillow 116.9/150: 78% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(11), potion_of_the_old_war
0:08.038 rip Fluffy_Pillow 131.9/150: 88% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(12), potion_of_the_old_war
0:09.042 shred Fluffy_Pillow 131.9/150: 88% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(14), potion_of_the_old_war
0:10.048 shred Fluffy_Pillow 126.9/150: 85% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(15), potion_of_the_old_war
0:11.056 rake Fluffy_Pillow 121.9/150: 81% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(17), potion_of_the_old_war
0:12.060 wild_charge Fluffy_Pillow 119.4/150: 80% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(18), potion_of_the_old_war
0:12.060 lunar_inspiration Fluffy_Pillow 119.4/150: 80% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, raid_movement, clearcasting, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(18), potion_of_the_old_war
0:12.260 auto_attack Fluffy_Pillow 119.4/150: 80% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(18), potion_of_the_old_war
0:13.065 ferocious_bite Fluffy_Pillow 134.4/150: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(19), potion_of_the_old_war
0:14.071 shred Fluffy_Pillow 124.4/150: 83% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:15.077 shred Fluffy_Pillow 139.4/150: 93% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:16.082 shred Fluffy_Pillow 134.4/150: 90% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:17.087 shred Fluffy_Pillow 129.4/150: 86% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points bloodlust, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:18.090 rip Fluffy_Pillow 100.0/100: 100% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:19.094 shred Fluffy_Pillow 85.0/100: 85% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:20.098 dash Fluffy_Pillow 60.0/100: 60% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:20.098 thrash_cat Fluffy_Pillow 60.0/100: 60% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
0:21.716 auto_attack Fluffy_Pillow 32.6/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20), potion_of_the_old_war
0:21.870 swipe_cat Fluffy_Pillow 36.4/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20), potion_of_the_old_war
0:23.896 swipe_cat Fluffy_Pillow 33.6/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
0:26.433 swipe_cat Fluffy_Pillow 38.5/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, clearcasting, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
0:27.436 thrash_cat Fluffy_Pillow 53.4/100: 53% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness, chaotic_energy(20)
0:28.541 auto_attack Fluffy_Pillow 18.4/100: 18% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness, scent_of_blood, chaotic_energy(20)
0:29.468 swipe_cat Fluffy_Pillow 33.8/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, dash, predatory_swiftness, scent_of_blood, chaotic_energy(20)
0:32.514 swipe_cat Fluffy_Pillow 46.2/100: 46% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points bloodlust, dash, chaotic_energy(20)
0:33.518 tigers_fury Fluffy_Pillow 16.2/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, chaotic_energy(20)
0:34.030 savage_roar Fluffy_Pillow 43.8/100: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points bloodlust, dash, ashamanes_energy, tigers_fury, chaotic_energy(20)
0:35.544 swipe_cat Fluffy_Pillow 66.4/100: 66% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points bloodlust, ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:36.550 swipe_cat Fluffy_Pillow 56.4/100: 56% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points bloodlust, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:38.830 thrash_cat Fluffy_Pillow 45.4/100: 45% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
0:39.836 swipe_cat Fluffy_Pillow 60.4/100: 60% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points bloodlust, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
0:40.839 skull_bash Fluffy_Pillow 42.4/100: 42% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
0:40.839 rake Fluffy_Pillow 42.4/100: 42% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points bloodlust, clearcasting, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
0:41.845 lunar_inspiration Fluffy_Pillow 53.9/100: 54% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
0:42.851 rip Fluffy_Pillow 35.5/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:43.856 Waiting 0.995 sec 17.0/100: 17% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:44.851 auto_attack Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:44.851 Waiting 1.100 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:45.951 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:46.955 Waiting 2.481 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:49.436 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.441 wild_charge Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
0:50.896 auto_attack Fluffy_Pillow 15.5/100: 16% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
0:53.767 thrash_cat Fluffy_Pillow 50.8/100: 51% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
0:56.816 swipe_cat Fluffy_Pillow 35.8/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar, scent_of_blood, chaotic_energy(20)
1:00.122 savage_roar Fluffy_Pillow 40.7/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, chaotic_energy(20)
1:00.822 auto_attack Fluffy_Pillow 0.7/100: 1% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:03.425 tigers_fury Fluffy_Pillow 38.6/100: 39% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:03.518 thrash_cat Fluffy_Pillow 59.7/100: 60% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:04.520 swipe_cat Fluffy_Pillow 41.2/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:05.526 swipe_cat Fluffy_Pillow 39.7/100: 40% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:06.531 swipe_cat Fluffy_Pillow 38.2/100: 38% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:10.093 rake Fluffy_Pillow 46.1/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:11.097 Waiting 0.705 sec 22.6/100: 23% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:11.802 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:12.807 Waiting 1.609 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
1:14.416 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
1:15.421 Waiting 1.409 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:16.830 auto_attack Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:16.830 Waiting 0.300 sec 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:17.130 skull_bash Fluffy_Pillow 31.9/100: 32% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:17.130 Waiting 0.800 sec 31.9/100: 32% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:17.930 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:18.933 Waiting 1.082 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:20.015 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:20.628 auto_attack Fluffy_Pillow 30.9/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:22.312 thrash_cat Fluffy_Pillow 51.4/100: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:25.107 swipe_cat Fluffy_Pillow 33.4/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood, chaotic_energy(20)
1:26.111 swipe_cat Fluffy_Pillow 12.0/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, scent_of_blood, chaotic_energy(20)
1:28.132 swipe_cat Fluffy_Pillow 47.1/100: 47% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points chaotic_energy(20)
1:31.181 savage_roar Fluffy_Pillow 37.1/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, chaotic_energy(20)
1:32.440 thrash_cat Fluffy_Pillow 51.6/100: 52% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:32.840 auto_attack Fluffy_Pillow 1.6/100: 2% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
1:33.446 tigers_fury Fluffy_Pillow 13.1/100: 13% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
1:33.518 swipe_cat Fluffy_Pillow 34.0/100: 34% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:34.778 swipe_cat Fluffy_Pillow 35.4/100: 35% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:35.782 swipe_cat Fluffy_Pillow 33.9/100: 34% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
1:36.787 swipe_cat Fluffy_Pillow 77.5/100: 77% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:38.045 swipe_cat Fluffy_Pillow 46.9/100: 47% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:40.070 Waiting 0.500 sec 25.2/100: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:40.570 rip Fluffy_Pillow 30.9/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
1:41.574 rake Fluffy_Pillow 12.4/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
1:42.579 Waiting 0.600 sec 23.9/100: 24% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:43.179 lunar_inspiration Fluffy_Pillow 30.8/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:44.183 Waiting 2.502 sec 12.4/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:46.685 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:47.689 Waiting 1.181 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:48.870 auto_attack Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:48.870 Waiting 1.200 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.070 wild_charge Fluffy_Pillow 39.9/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:50.580 auto_attack Fluffy_Pillow 45.8/100: 46% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
1:51.089 thrash_cat Fluffy_Pillow 51.6/100: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
1:53.630 rip Fluffy_Pillow_Add1 30.8/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, scent_of_blood, chaotic_energy(20)
1:54.633 skull_bash Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
1:56.677 swipe_cat Fluffy_Pillow 35.7/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, chaotic_energy(20)
1:57.682 swipe_cat Fluffy_Pillow 47.3/100: 47% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, chaotic_energy(20)
2:02.010 thrash_cat Fluffy_Pillow 51.9/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, chaotic_energy(20)
2:03.272 tigers_fury Fluffy_Pillow 16.4/100: 16% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, scent_of_blood, chaotic_energy(20)
2:03.518 swipe_cat Fluffy_Pillow 39.2/100: 39% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
2:04.522 swipe_cat Fluffy_Pillow 37.8/100: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points raid_movement, ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
2:04.822 auto_attack Fluffy_Pillow 4.8/100: 5% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
2:05.526 swipe_cat Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
2:06.529 savage_roar Fluffy_Pillow 34.8/100: 35% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, tigers_fury, chaotic_energy(20)
2:07.533 swipe_cat Fluffy_Pillow 46.3/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:10.584 rake Fluffy_Pillow 36.3/100: 36% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:11.589 Waiting 1.556 sec 12.9/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:13.145 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:14.150 Waiting 2.509 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:16.659 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:17.663 Waiting 1.582 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:19.245 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
2:20.448 auto_attack Fluffy_Pillow 12.2/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:23.566 thrash_cat Fluffy_Pillow 50.3/100: 50% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:26.612 swipe_cat Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
2:30.174 swipe_cat Fluffy_Pillow 43.2/100: 43% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
2:31.180 thrash_cat Fluffy_Pillow 54.7/100: 55% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, chaotic_energy(20)
2:32.184 skull_bash Fluffy_Pillow 16.2/100: 16% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points scent_of_blood, chaotic_energy(20)
2:33.462 tigers_fury Fluffy_Pillow 30.9/100: 31% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points scent_of_blood, chaotic_energy(20)
2:33.518 swipe_cat Fluffy_Pillow 51.5/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, scent_of_blood, tigers_fury, chaotic_energy(20)
2:34.521 swipe_cat Fluffy_Pillow 50.0/100: 50% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, scent_of_blood, tigers_fury, chaotic_energy(20)
2:35.525 swipe_cat Fluffy_Pillow 48.6/100: 49% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points ashamanes_energy, tigers_fury, chaotic_energy(20)
2:36.885 auto_attack Fluffy_Pillow 38.0/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury, chaotic_energy(20)
2:37.042 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury, chaotic_energy(20)
2:40.085 rake Fluffy_Pillow 35.9/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:41.090 Waiting 1.594 sec 12.4/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
2:42.684 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:43.689 Waiting 2.510 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:46.199 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:47.204 Waiting 2.480 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
2:49.684 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points savage_roar, chaotic_energy(20)
2:50.690 wild_charge Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, savage_roar, chaotic_energy(20)
2:51.046 auto_attack Fluffy_Pillow 15.5/100: 16% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, savage_roar, chaotic_energy(20)
2:52.421 auto_attack Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
2:54.003 thrash_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
2:56.790 rip Fluffy_Pillow 32.6/100: 33% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, scent_of_blood, chaotic_energy(20)
3:00.612 swipe_cat Fluffy_Pillow 46.5/100: 46% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:03.405 tigers_fury Fluffy_Pillow 33.5/100: 34% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, chaotic_energy(20)
3:03.518 berserk Fluffy_Pillow 54.8/100: 55% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, tigers_fury, chaotic_energy(20)
3:03.518 thrash_cat Fluffy_Pillow 54.8/150: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, tigers_fury, chaotic_energy(20)
3:04.522 swipe_cat Fluffy_Pillow 61.3/150: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:05.527 swipe_cat Fluffy_Pillow 76.4/150: 51% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, ashamanes_energy, berserk, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:06.531 swipe_cat Fluffy_Pillow 91.4/150: 61% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points feral_instinct, berserk, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:07.535 swipe_cat Fluffy_Pillow 86.4/150: 58% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points feral_instinct, berserk, predatory_swiftness, tigers_fury, chaotic_energy(20)
3:08.538 savage_roar Fluffy_Pillow 75.4/150: 50% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, tigers_fury, chaotic_energy(20)
3:08.838 auto_attack Fluffy_Pillow 55.4/150: 37% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:09.541 skull_bash Fluffy_Pillow 66.9/150: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:09.541 swipe_cat Fluffy_Pillow 66.9/150: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:10.547 rake Fluffy_Pillow 56.0/150: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:11.550 lunar_inspiration Fluffy_Pillow 50.0/150: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:12.556 shred Fluffy_Pillow 46.5/150: 31% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:13.559 rip Fluffy_Pillow 38.1/150: 25% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:14.564 shred Fluffy_Pillow 34.6/150: 23% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:15.570 shred Fluffy_Pillow 26.1/150: 17% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:16.575 Waiting 0.638 sec 17.7/150: 12% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:17.213 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:18.220 Waiting 1.836 sec 16.5/150: 11% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20)
3:20.056 wild_charge Fluffy_Pillow 37.6/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:20.568 auto_attack Fluffy_Pillow 43.5/100: 43% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:21.335 thrash_cat Fluffy_Pillow 52.3/100: 52% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:23.874 rip Fluffy_Pillow_Add1 31.4/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
3:24.874 auto_attack Fluffy_Pillow 1.4/100: 1% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
3:27.179 skull_bash Fluffy_Pillow 39.4/100: 39% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:27.692 swipe_cat Fluffy_Pillow 45.3/100: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:32.267 thrash_cat Fluffy_Pillow 52.8/100: 53% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:33.271 tigers_fury Fluffy_Pillow 14.3/100: 14% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, scent_of_blood, chaotic_energy(20)
3:33.518 swipe_cat Fluffy_Pillow 37.1/100: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:34.523 swipe_cat Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:35.527 swipe_cat Fluffy_Pillow 34.2/100: 34% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, predatory_swiftness, scent_of_blood, tigers_fury, chaotic_energy(20)
3:36.530 swipe_cat Fluffy_Pillow 32.7/100: 33% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, tigers_fury, chaotic_energy(20)
3:37.534 savage_roar Fluffy_Pillow 44.2/100: 44% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury, chaotic_energy(20)
3:39.050 swipe_cat Fluffy_Pillow 21.6/100: 22% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:40.054 wild_charge Fluffy_Pillow 33.1/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:40.054 lunar_inspiration Fluffy_Pillow 33.1/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:40.254 auto_attack Fluffy_Pillow 3.1/100: 3% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
3:42.848 rake Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:43.854 Waiting 1.656 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:45.510 rip Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:46.515 skull_bash Fluffy_Pillow 12.3/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:46.515 Waiting 2.509 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
3:49.024 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.028 dash Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
3:50.028 thrash_cat Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:51.741 auto_attack Fluffy_Pillow 20.0/100: 20% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
3:52.815 swipe_cat Fluffy_Pillow 34.6/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
3:56.119 wild_charge Fluffy_Pillow 39.5/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:56.319 auto_attack Fluffy_Pillow 39.5/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
3:56.630 swipe_cat Fluffy_Pillow 45.4/100: 45% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points dash, predatory_swiftness, savage_roar, chaotic_energy(20)
4:00.963 thrash_cat Fluffy_Pillow 50.1/100: 50% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points dash, savage_roar, chaotic_energy(20)
4:02.479 swipe_cat Fluffy_Pillow 17.5/100: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points clearcasting, dash, scent_of_blood, chaotic_energy(20)
4:03.482 savage_roar Fluffy_Pillow 41.0/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, dash, scent_of_blood, chaotic_energy(20)
4:04.486 swipe_cat Fluffy_Pillow 52.5/100: 53% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points dash, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:05.490 tigers_fury Fluffy_Pillow 31.0/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:05.490 swipe_cat Fluffy_Pillow 51.0/100: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:07.261 swipe_cat Fluffy_Pillow 46.4/100: 46% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:08.266 skull_bash Fluffy_Pillow 32.9/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:08.521 thrash_cat Fluffy_Pillow 55.8/100: 56% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:11.318 rake Fluffy_Pillow 37.9/100: 38% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
4:12.323 Waiting 0.919 sec 14.5/100: 14% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points raid_movement, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
4:13.242 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:13.242 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:13.742 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:14.745 rip Fluffy_Pillow 12.2/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:15.750 Waiting 1.506 sec 23.8/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:17.256 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:18.260 Waiting 1.781 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:20.041 wild_charge Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:20.652 auto_attack Fluffy_Pillow 38.9/100: 39% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:21.576 thrash_cat Fluffy_Pillow 50.6/100: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:23.349 skull_bash Fluffy_Pillow 21.0/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:24.372 swipe_cat Fluffy_Pillow 32.7/100: 33% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:25.377 swipe_cat Fluffy_Pillow 56.3/100: 56% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:27.401 swipe_cat Fluffy_Pillow 46.5/100: 46% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, chaotic_energy(20)
4:28.405 swipe_cat Fluffy_Pillow 13.0/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points raid_movement, clearcasting, chaotic_energy(20)
4:28.805 auto_attack Fluffy_Pillow 13.0/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points chaotic_energy(20)
4:30.944 savage_roar Fluffy_Pillow 42.2/100: 42% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points chaotic_energy(20)
4:33.227 thrash_cat Fluffy_Pillow 28.4/100: 28% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
4:34.232 swipe_cat Fluffy_Pillow 39.9/100: 40% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:35.490 tigers_fury Fluffy_Pillow 21.3/100: 21% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, scent_of_blood, chaotic_energy(20)
4:35.490 swipe_cat Fluffy_Pillow 41.3/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
4:36.494 swipe_cat Fluffy_Pillow 39.8/100: 40% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, predatory_swiftness, savage_roar, scent_of_blood, tigers_fury, chaotic_energy(20)
4:38.266 swipe_cat Fluffy_Pillow 47.2/100: 47% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:40.037 rake Fluffy_Pillow 42.5/100: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:41.043 rip Fluffy_Pillow 19.1/100: 19% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:42.049 lunar_inspiration Fluffy_Pillow 30.6/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:43.055 Waiting 1.120 sec 12.1/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
4:44.175 wild_charge Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:44.175 Waiting 0.100 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:44.275 auto_attack Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:44.275 Waiting 1.300 sec 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:45.575 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:46.580 Waiting 2.480 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:49.060 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:50.065 skull_bash Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
4:52.467 auto_attack Fluffy_Pillow 39.0/100: 39% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
4:53.388 thrash_cat Fluffy_Pillow 50.7/100: 51% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, chaotic_energy(20)
4:55.669 ferocious_bite Fluffy_Pillow 26.9/100: 27% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points scent_of_blood, chaotic_energy(20)
4:59.741 swipe_cat Fluffy_Pillow 46.7/100: 47% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points chaotic_energy(20)
5:00.845 auto_attack Fluffy_Pillow 13.3/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points chaotic_energy(20)
5:04.062 thrash_cat Fluffy_Pillow 51.3/100: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points chaotic_energy(20)
5:05.324 tigers_fury Fluffy_Pillow 15.8/100: 16% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points scent_of_blood, chaotic_energy(20)
5:05.490 swipe_cat Fluffy_Pillow 37.7/100: 38% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points ashamanes_energy, scent_of_blood, tigers_fury, chaotic_energy(20)
5:06.494 swipe_cat Fluffy_Pillow 36.2/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points clearcasting, ashamanes_energy, scent_of_blood, tigers_fury, chaotic_energy(20)
5:07.499 swipe_cat Fluffy_Pillow 79.8/100: 80% energy | 704000.0/704000: 100% mana | 3.0/5: 61% combo_points ashamanes_energy, scent_of_blood, tigers_fury, chaotic_energy(20)
5:08.503 swipe_cat Fluffy_Pillow 78.3/100: 78% energy | 704000.0/704000: 100% mana | 4.0/5: 81% combo_points clearcasting, tigers_fury, chaotic_energy(20)
5:09.509 savage_roar Fluffy_Pillow 89.8/100: 90% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points tigers_fury, chaotic_energy(20)
5:10.512 rake Fluffy_Pillow 61.3/100: 61% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:11.518 ferocious_bite Fluffy_Pillow 37.9/100: 38% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points clearcasting, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:12.523 Waiting 0.500 sec 24.4/100: 24% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:13.023 lunar_inspiration Fluffy_Pillow 30.2/100: 30% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:14.027 Waiting 2.060 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.087 wild_charge Fluffy_Pillow 35.3/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.087 Waiting 0.100 sec 35.3/100: 35% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.187 auto_attack Fluffy_Pillow 36.5/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.187 Waiting 0.400 sec 36.5/100: 36% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:16.587 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:17.594 Waiting 2.478 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:20.072 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:21.077 Waiting 2.481 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:23.558 savage_roar Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, chaotic_energy(20)
5:26.604 rake Fluffy_Pillow 36.0/100: 36% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:27.609 Waiting 1.184 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:28.793 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:29.798 Waiting 1.173 sec 11.5/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.971 skull_bash Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:30.971 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:31.471 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:32.475 Waiting 1.110 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:33.585 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:33.585 Waiting 1.400 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:34.985 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:35.990 tigers_fury Fluffy_Pillow 12.6/100: 13% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points savage_roar, chaotic_energy(20)
5:35.990 Waiting 0.700 sec 32.6/100: 33% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, savage_roar, tigers_fury, chaotic_energy(20)
5:36.690 rake Fluffy_Pillow 40.6/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points ashamanes_energy, savage_roar, tigers_fury, chaotic_energy(20)
5:37.695 Waiting 1.300 sec 37.2/100: 37% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points ashamanes_energy, savage_roar, tigers_fury, chaotic_energy(20)
5:38.995 ferocious_bite Fluffy_Pillow 92.1/100: 92% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points savage_roar, tigers_fury, chaotic_energy(20)
5:39.997 shred Fluffy_Pillow 53.6/100: 54% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:41.003 Waiting 0.500 sec 25.1/100: 25% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:41.503 lunar_inspiration Fluffy_Pillow 30.9/100: 31% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:42.508 Waiting 2.498 sec 12.4/100: 12% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20)
5:45.006 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
5:46.011 shred Fluffy_Pillow 52.6/100: 53% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:47.015 Waiting 1.000 sec 24.1/100: 24% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:48.015 wild_charge Fluffy_Pillow 35.6/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:48.015 Waiting 0.200 sec 35.6/100: 36% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points raid_movement, wild_charge_movement, predatory_swiftness, savage_roar, chaotic_energy(20)
5:48.215 auto_attack Fluffy_Pillow 37.9/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:48.215 Waiting 0.200 sec 37.9/100: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:48.415 savage_roar Fluffy_Pillow 40.2/100: 40% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:51.463 rake Fluffy_Pillow 35.2/100: 35% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:52.465 Waiting 2.561 sec 11.7/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:55.026 shred Fluffy_Pillow 41.1/100: 41% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:56.031 Waiting 1.181 sec 12.6/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:57.212 ferocious_bite Fluffy_Pillow 26.1/100: 26% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:58.217 Waiting 1.173 sec 11.5/100: 12% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:59.390 potion Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
5:59.390 Waiting 0.500 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
5:59.890 lunar_inspiration Fluffy_Pillow 30.7/100: 31% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:00.893 Waiting 1.111 sec 12.2/100: 12% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points savage_roar, chaotic_energy(20), potion_of_the_old_war
6:03.025 rake Fluffy_Pillow 36.7/100: 37% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points savage_roar, chaotic_energy(20), potion_of_the_old_war
6:04.030 wild_charge Fluffy_Pillow 13.2/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:04.030 Waiting 1.024 sec 13.2/100: 13% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points raid_movement, wild_charge_movement, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:05.054 auto_attack Fluffy_Pillow 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points savage_roar, chaotic_energy(20), potion_of_the_old_war
6:05.054 Waiting 0.700 sec 25.0/100: 25% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points savage_roar, chaotic_energy(20), potion_of_the_old_war
6:05.754 tigers_fury Fluffy_Pillow 33.0/100: 33% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points savage_roar, chaotic_energy(20), potion_of_the_old_war
6:05.990 berserk Fluffy_Pillow 55.7/100: 56% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points ashamanes_energy, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:05.990 shred Fluffy_Pillow 55.7/150: 37% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, ashamanes_energy, berserk, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:06.994 shred Fluffy_Pillow 67.3/150: 45% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, ashamanes_energy, berserk, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:07.998 ferocious_bite Fluffy_Pillow 78.8/150: 53% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, ashamanes_energy, berserk, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:09.003 shred Fluffy_Pillow 85.3/150: 57% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:10.007 lunar_inspiration Fluffy_Pillow 76.8/150: 51% energy | 704000.0/704000: 100% mana | 1.0/5: 20% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:11.011 shred Fluffy_Pillow 73.4/150: 49% energy | 704000.0/704000: 100% mana | 3.0/5: 60% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:12.014 skull_bash Fluffy_Pillow 64.9/150: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:12.014 shred Fluffy_Pillow 64.9/150: 43% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:13.019 savage_roar Fluffy_Pillow 56.4/150: 38% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, feral_instinct, berserk, predatory_swiftness, savage_roar, tigers_fury, chaotic_energy(20), potion_of_the_old_war
6:14.023 rake Fluffy_Pillow 67.9/150: 45% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:15.027 shred Fluffy_Pillow 62.0/150: 41% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:16.030 shred Fluffy_Pillow 53.5/150: 36% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:17.035 ferocious_bite Fluffy_Pillow 45.0/150: 30% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:18.038 shred Fluffy_Pillow 31.5/150: 21% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:19.042 shred Fluffy_Pillow 23.0/150: 15% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.047 wild_charge Fluffy_Pillow 14.6/150: 10% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.047 Waiting 0.909 sec 14.6/150: 10% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points raid_movement, wild_charge_movement, feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.956 auto_attack Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:20.956 shred Fluffy_Pillow 25.0/150: 17% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points feral_instinct, berserk, predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:21.962 Waiting 6.337 sec 16.5/100: 17% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20), potion_of_the_old_war
6:28.299 ferocious_bite Fluffy_Pillow 89.3/100: 89% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points clearcasting, predatory_swiftness, savage_roar, chaotic_energy(20)
6:29.303 rake Fluffy_Pillow 75.8/100: 76% energy | 704000.0/704000: 100% mana | 0.0/5: 0% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
6:30.306 lunar_inspiration Fluffy_Pillow 52.3/100: 52% energy | 704000.0/704000: 100% mana | 2.0/5: 40% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
6:31.311 Waiting 0.600 sec 33.8/100: 34% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
6:31.911 shred Fluffy_Pillow 40.7/100: 41% energy | 704000.0/704000: 100% mana | 4.0/5: 80% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)
6:32.917 Waiting 2.509 sec 12.3/100: 12% energy | 704000.0/704000: 100% mana | 5.0/5: 100% combo_points predatory_swiftness, savage_roar, chaotic_energy(20)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 24349 22642 12537 (10861)
Stamina 36617 36617 21811
Intellect 7651 7326 0
Spirit 0 0 0
Health 2197020 2197020 0
Mana 704000 704000 0
Rage 100 100 0
Energy 100 100 0
Astral Power 100 100 0
Combo Points 5 5 0
Spell Power 29219 27170 0
Crit 41.37% 41.37% 9231
Haste 14.76% 14.76% 4798
Damage / Heal Versatility 3.30% 3.30% 1319
Attack Power 24349 22642 0
Mastery 57.26% 55.12% 6847
Armor 2145 2145 2145
Run Speed 10 0 0

Gear

Source Slot Average Item Level: 863.00
Local Head Biornskin Hood
ilevel: 865, stats: { 281 Armor, +1491 AgiInt, +2237 Sta, +809 Crit, +571 Mastery }
Local Neck Pendant of the Stormforger
ilevel: 845, stats: { +1045 Sta, +1132 Crit, +669 Haste }, gems: { +150 Crit }
Local Shoulders Otherworldy Leather Mantle
ilevel: 865, stats: { 259 Armor, +1678 Sta, +1119 AgiInt, +628 Crit, +407 Mastery }
Local Chest Ekowraith, Creator of Worlds
ilevel: 895, stats: { 382 Armor, +2959 Sta, +1973 AgiInt, +552 Crit, +993 Mastery }
Local Waist Swordsinger's Belt
ilevel: 865, stats: { 195 Armor, +1119 AgiInt, +1678 Sta, +628 Mastery, +407 Haste, +638 unknown }
Local Legs Felbat Leather Leggings
ilevel: 850, stats: { 288 Armor, +1297 AgiInt, +1945 Sta, +792 Crit, +512 Vers }
Local Feet Mana-Tanned Sandals
ilevel: 875, stats: { 246 Armor, +1842 Sta, +1228 AgiInt, +744 Mastery, +330 Crit }
Local Wrists Wax-Sealed Leather Bracers
ilevel: 860, stats: { 149 Armor, +1201 Sta, +801 AgiInt, +545 Haste, +218 Crit }
Local Hands Gravelworn Handguards
ilevel: 860, stats: { 213 Armor, +1068 AgiInt, +1601 Sta, +638 Haste, +377 Crit }
Local Finger1 Signet of the Highborne Magi
ilevel: 850, stats: { +1094 Sta, +1154 Mastery, +682 Crit }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Mastery }, enchant: { +150 Crit }
Local Trinket1 Chaos Talisman
ilevel: 850, stats: { +932 Haste }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Stormsky Greatcloak
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +454 Crit, +294 Mastery }, enchant: { +150 Agi }
Local Main Hand Fangs of Ashamane
ilevel: 884, weapon: { 3131 - 5817, 1.8 }, stats: { +763 Agi, +1145 Sta, +322 Crit, +310 Mastery }, relics: { +46 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fangs of Ashamane
ilevel: 884, weapon: { 3131 - 5817, 1.8 }, stats: { +763 Agi, +1145 Sta, +322 Crit, +310 Mastery }

Talents

Level
15 Predator (Feral Druid) Blood Scent (Feral Druid) Lunar Inspiration (Feral Druid)
30 Renewal Displacer Beast Wild Charge
45 Balance Affinity Guardian Affinity (Feral Druid) Restoration Affinity
60 Mighty Bash Mass Entanglement Typhoon
75 Soul of the Forest (Feral Druid) Incarnation: King of the Jungle (Feral Druid) Savage Roar (Feral Druid)
90 Sabertooth (Feral Druid) Jagged Wounds (Feral Druid) Elune's Guidance (Feral Druid)
100 Brutal Slash (Feral Druid) Bloodtalons (Feral Druid) Moment of Clarity (Feral Druid)

Profile

druid="Oinkie"
origin="https://us.api.battle.net/wow/character/thrall/Oinkie/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/231/133784295-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=inscription=718/herbalism=815
talents=3311322
artifact=58:0:0:0:0:1153:1:1154:1:1155:1:1156:1:1157:1:1158:1:1161:3:1162:3:1163:3:1164:3:1165:3:1166:3:1167:3:1327:1
spec=feral

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=nightborne_delicacy_platter
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/cat_form
actions.precombat+=/prowl
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=dash,if=!buff.cat_form.up
actions+=/cat_form
actions+=/wild_charge
actions+=/displacer_beast,if=movement.distance>10
actions+=/dash,if=movement.distance&buff.displacer_beast.down&buff.wild_charge_movement.down
actions+=/rake,if=buff.prowl.up
actions+=/auto_attack
actions+=/skull_bash
actions+=/berserk,if=buff.tigers_fury.up
actions+=/incarnation,if=cooldown.tigers_fury.remains<gcd
actions+=/potion,name=old_war,if=((buff.berserk.remains>10|buff.incarnation.remains>20)&(target.time_to_die<180|(trinket.proc.all.react&target.health.pct<25)))|target.time_to_die<=40
actions+=/tigers_fury,if=(!buff.clearcasting.react&energy.deficit>=60)|energy.deficit>=80|(t18_class_trinket&buff.berserk.up&buff.tigers_fury.down)
actions+=/incarnation,if=energy.time_to_max>1&energy>=35
# Keep Rip from falling off during execute range.
actions+=/ferocious_bite,cycle_targets=1,if=dot.rip.ticking&dot.rip.remains<3&target.time_to_die>3&(target.health.pct<25|talent.sabertooth.enabled)
actions+=/call_action_list,name=sbt_opener,if=talent.sabertooth.enabled&time<20
actions+=/call_action_list,name=finisher
actions+=/call_action_list,name=generator

# Use Savage Roar if it's expired and you're at 5 combo points or are about to use Brutal Slash
actions.finisher=pool_resource,for_next=1
actions.finisher+=/savage_roar,if=!buff.savage_roar.up&(combo_points=5|(talent.brutal_slash.enabled&spell_targets.brutal_slash>desired_targets&action.brutal_slash.charges>0))
# Thrash has higher priority than finishers at 5 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.thrash_cat>=5
# Replace Rip with Swipe at 8 targets
actions.finisher+=/pool_resource,for_next=1
actions.finisher+=/swipe_cat,if=spell_targets.swipe_cat>=8
# Refresh Rip at 8 seconds or for a stronger Rip
actions.finisher+=/rip,cycle_targets=1,if=(!ticking|(remains<8&target.health.pct>25&!talent.sabertooth.enabled)|persistent_multiplier>dot.rip.pmultiplier)&target.time_to_die-remains>tick_time*4&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Refresh Savage Roar early with Jagged Wounds
actions.finisher+=/savage_roar,if=(buff.savage_roar.remains<=10.5|(buff.savage_roar.remains<=7.2&!talent.jagged_wounds.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|buff.clearcasting.react|talent.soul_of_the_forest.enabled|!dot.rip.ticking|(dot.rake.remains<1.5&spell_targets.swipe_cat<6))
# Replace FB with Swipe at 6 targets for Bloodtalons or 3 targets otherwise.
actions.finisher+=/swipe_cat,if=combo_points=5&(spell_targets.swipe_cat>=6|(spell_targets.swipe_cat>=3&!talent.bloodtalons.enabled))&combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))
actions.finisher+=/ferocious_bite,max_energy=1,cycle_targets=1,if=combo_points=5&(energy.time_to_max<1|buff.berserk.up|buff.incarnation.up|buff.elunes_guidance.up|cooldown.tigers_fury.remains<3|set_bonus.tier18_4pc|(talent.moment_of_clarity.enabled&buff.clearcasting.react))

# Brutal Slash if there's adds up
actions.generator=brutal_slash,if=spell_targets.brutal_slash>desired_targets&combo_points<5
actions.generator+=/ashamanes_frenzy,if=combo_points<=2&buff.elunes_guidance.down&(buff.bloodtalons.up|!talent.bloodtalons.enabled)&(buff.savage_roar.up|!talent.savage_roar.enabled)
# Pool energy for Elune's Guidance when it's coming off cooldown.
actions.generator+=/pool_resource,if=talent.elunes_guidance.enabled&combo_points=0&energy<action.ferocious_bite.cost+25-energy.regen*cooldown.elunes_guidance.remains
actions.generator+=/elunes_guidance,if=talent.elunes_guidance.enabled&combo_points=0&energy>=action.ferocious_bite.cost+25
# Spam Thrash over Rake or Moonfire at 9 targets with Brutal Slash talent.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,if=talent.brutal_slash.enabled&spell_targets.thrash_cat>=9
# Use Swipe over Rake or Moonfire at 6 targets.
actions.generator+=/pool_resource,for_next=1
actions.generator+=/swipe_cat,if=spell_targets.swipe_cat>=6
# Refresh Rake early with Bloodtalons
actions.generator+=/pool_resource,for_next=1
actions.generator+=/rake,cycle_targets=1,if=combo_points<5&(!ticking|(!talent.bloodtalons.enabled&remains<duration*0.3)|(talent.bloodtalons.enabled&buff.bloodtalons.up&(!talent.soul_of_the_forest.enabled&remains<=7|remains<=5)&persistent_multiplier>dot.rake.pmultiplier*0.80))&target.time_to_die-remains>tick_time
actions.generator+=/moonfire_cat,cycle_targets=1,if=combo_points<5&remains<=4.2&target.time_to_die-remains>tick_time*2
actions.generator+=/pool_resource,for_next=1
actions.generator+=/thrash_cat,cycle_targets=1,if=remains<=duration*0.3&spell_targets.swipe_cat>=2
# Brutal Slash if you would cap out charges before the next adds spawn
actions.generator+=/brutal_slash,if=combo_points<5&((raid_event.adds.exists&raid_event.adds.in>(1+max_charges-charges_fractional)*15)|(!raid_event.adds.exists&(charges_fractional>2.66&time>10)))
actions.generator+=/swipe_cat,if=combo_points<5&spell_targets.swipe_cat>=3
actions.generator+=/shred,if=combo_points<5&(spell_targets.swipe_cat<3|talent.brutal_slash.enabled)

# Force use of Tiger's Fury before applying Rip.
actions.sbt_opener=tigers_fury,if=!dot.rip.ticking&combo_points=5

head=biornskin_hood,id=134196,bonus_id=3414/1527/3336
neck=pendant_of_the_stormforger,id=133767,bonus_id=3411/1808/1497/1813,gems=150crit
shoulders=otherworldy_leather_mantle,id=139206,bonus_id=1805/1487
back=stormsky_greatcloak,id=134202,bonus_id=3473/1517/3337,enchant=150agi
chest=ekowraith_creator_of_worlds,id=137015,bonus_id=1811
wrists=waxsealed_leather_bracers,id=141429,bonus_id=3466/1472
hands=gravelworn_handguards,id=134443,bonus_id=3412/1512/3336
waist=swordsingers_belt,id=134287,bonus_id=3413/43/1527/3337
legs=felbat_leather_leggings,id=134370,bonus_id=1727/1512/3336
feet=manatanned_sandals,id=141430,bonus_id=1487/3337
finger1=signet_of_the_highborne_magi,id=134537,bonus_id=3411/1808/1502/3336,gems=150crit,enchant=150crit
finger2=roughhammered_silver_ring,id=134191,bonus_id=3432/1512/3337,enchant=150crit
trinket1=chaos_talisman,id=137459,bonus_id=1727/1502/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=fangs_of_ashamane,id=128860,bonus_id=723,gem_id=142308/139257/142189/0,relic_id=3453:1472/1807:1472/3452:1472/0
off_hand=fangs_of_ashamane,id=128859

# Gear Summary
# gear_ilvl=863.31
# gear_agility=12537
# gear_stamina=21811
# gear_crit_rating=9231
# gear_haste_rating=3998
# gear_mastery_rating=6847
# gear_versatility_rating=1319
# gear_armor=2145

Rothlandra

Rothlandra : 449462 dps, 270529 dps to main target

  • Race: Blood Elf
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
449462.0 449462.0 641.6 / 0.143% 125617.3 / 27.9% 25024.9
RPS Out RPS In Primary Resource Waiting APM Active Skill
17.8 17.8 Focus 12.57% 39.0 100.0% 95%
Origin https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Posthaste
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • mining: 266
  • herbalism: 312
Scale Factors for Rothlandra Damage Per Second
Mastery Agi Haste Crit Vers
Scale Factors 14.04 11.90 11.64 10.50 10.41
Normalized 1.18 1.00 0.98 0.88 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.81 0.81 0.80 0.81 0.81
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi ~= Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.90, CritRating=10.50, HasteRating=11.64, MasteryRating=14.04, Versatility=10.41 )

Scale Factors for other metrics

Scale Factors for Rothlandra Damage Per Second
Mastery Agi Haste Crit Vers
Scale Factors 14.04 11.90 11.64 10.50 10.41
Normalized 1.18 1.00 0.98 0.88 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.81 0.81 0.80 0.81 0.81
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi ~= Haste > Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.90, CritRating=10.50, HasteRating=11.64, MasteryRating=14.04, Versatility=10.41 )
Scale Factors for Rothlandra Priority Target Damage Per Second
Mastery Haste Agi Crit Vers
Scale Factors 8.90 8.66 6.94 6.63 6.52
Normalized 1.28 1.25 1.00 0.96 0.94
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.26 0.27 0.26 0.26
Gear Ranking
Optimizers
Ranking
  • Mastery ~= Haste > Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=6.94, CritRating=6.63, HasteRating=8.66, MasteryRating=8.90, Versatility=6.52 )
Scale Factors for Rothlandra Damage Per Second (Effective)
Mastery Agi Haste Crit Vers
Scale Factors 14.04 11.90 11.64 10.50 10.41
Normalized 1.18 1.00 0.98 0.88 0.87
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Crit > Vers
Pawn string ( Pawn: v1: "Rothlandra": Agility=11.90, CritRating=10.50, HasteRating=11.64, MasteryRating=14.04, Versatility=10.41 )
Scale Factors for Rothlandra Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for Rothlandra Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )
Scale Factors for RothlandraTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Rothlandra": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Rothlandra 449462
Aimed Shot 107769 (126383) 24.2% (28.3%) 116.2 3.43sec 435727 292647 Direct 116.1 243644 591130 371922 36.9%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 116.19 116.08 0.00 0.00 1.4889 0.0000 43171105.52 63465614.40 31.98 292646.83 292646.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.22 63.08% 243644.45 106109 265272 243516.37 214744 262705 17840639 26227429 31.98
crit 42.85 36.92% 591129.95 226012 864787 590841.60 496880 704203 25330466 37238185 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 18614 4.2% 0.0 0.00sec 0 0 Direct 104.0 46991 114423 71702 36.6%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 103.98 0.00 0.00 0.0000 0.0000 7455332.56 10960045.05 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 65.87 63.36% 46990.76 20806 52014 47007.13 32695 52014 3095480 4550649 31.98
crit 38.10 36.64% 114423.28 44316 169566 114306.15 68699 153742 4359853 6409397 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 15084 3.4% 163.6 2.45sec 36896 15113 Direct 163.6 27258 59636 36895 29.8%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 163.61 163.61 0.00 0.00 2.4413 0.0000 6036555.86 8874308.91 31.98 15113.15 15113.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.91 70.24% 27258.47 27258 27258 27258.47 27258 27258 3132328 4604819 31.98
crit 48.70 29.76% 59636.22 54517 81775 59632.63 54517 65819 2904228 4269490 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 82045 18.2% 19.3 21.28sec 1686500 687697 Periodic 1037.2 23680 51147 31387 28.1% 10.6%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.30 0.00 294.41 1037.24 2.4524 0.1443 32555577.26 47859782.32 31.98 687697.03 687697.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 746.2 71.94% 23679.89 18576 37153 23668.41 22559 25200 17670367 25977114 31.98
crit 291.0 28.06% 51147.45 37153 111459 51178.54 44051 58690 14885210 21882668 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8741 1.9% 32.5 3.39sec 106106 0 Direct 32.4 79979 187991 106501 24.6%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.52 32.40 0.00 0.00 0.0000 0.0000 3451005.17 3451005.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.45 75.45% 79978.59 79979 79979 79978.59 79979 79979 1955296 1955296 0.00
crit 7.96 24.55% 187991.38 159957 239936 187813.54 0 239936 1495709 1495709 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Marked Shot 137248 30.4% 36.9 10.90sec 1472759 1305777 Direct 119.6 317849 683293 454077 37.3%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.88 119.63 0.00 0.00 1.1279 0.0000 54319024.97 79854111.94 31.98 1305777.18 1305777.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 75.03 62.72% 317849.27 127713 319283 317853.14 298758 319283 23849081 35060407 31.98
crit 44.59 37.28% 683293.46 255427 957849 683314.43 603090 802522 30469944 44793704 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
Pepper Breath 4183 0.9% 20.1 19.82sec 83378 0 Periodic 98.6 16973 0 16973 0.0% 6.2%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.08 0.00 99.85 98.64 0.0000 0.2498 1674303.61 1674303.61 0.00 67138.65 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 98.6 100.00% 16973.03 68 16990 16973.65 16610 16990 1674304 1674304 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Sidewinders 55005 12.2% 45.1 8.90sec 482326 424009 Direct 154.8 108139 230828 140657 26.5%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.14 154.78 0.00 0.00 1.1376 0.0000 21770325.08 21770325.08 0.00 424009.14 424009.14
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 113.75 73.50% 108139.19 108139 108139 108139.19 108139 108139 12301295 12301295 0.00
crit 41.02 26.50% 230827.68 216278 324418 230748.24 216278 259534 9469030 9469030 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 20772 4.7% 15.8 24.49sec 524998 420330 Direct 16.8 371529 788382 494799 29.6%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.84 16.81 0.00 0.00 1.2490 0.0000 8315809.73 12225027.99 31.98 420330.05 420330.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.84 70.43% 371529.47 371529 371529 371529.47 371529 371529 4397974 6465438 31.98
crit 4.97 29.57% 788381.99 743059 1114588 785285.92 0 1114588 3917836 5759590 31.86
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Rothlandra
Arcane Torrent 4.8 91.04sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.83 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:80483
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
Spelldata
  • id:80483
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=15} of your Focus. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Rothlandra
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 3.4 142.28sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.43 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 19.76% 0.0(0.0) 1.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 7.2 293.0 43.5sec 1.2sec 30.53% 30.53% 180.5(180.5) 6.2

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.16%
  • bullseye_2:0.17%
  • bullseye_3:0.15%
  • bullseye_4:0.14%
  • bullseye_5:4.45%
  • bullseye_6:0.13%
  • bullseye_7:0.12%
  • bullseye_8:0.12%
  • bullseye_9:0.12%
  • bullseye_10:2.84%
  • bullseye_11:0.11%
  • bullseye_12:0.11%
  • bullseye_13:0.10%
  • bullseye_14:0.10%
  • bullseye_15:0.42%
  • bullseye_16:0.09%
  • bullseye_17:0.09%
  • bullseye_18:0.09%
  • bullseye_19:0.10%
  • bullseye_20:0.42%
  • bullseye_21:0.10%
  • bullseye_22:0.10%
  • bullseye_23:0.11%
  • bullseye_24:0.11%
  • bullseye_25:0.44%
  • bullseye_26:0.11%
  • bullseye_27:0.11%
  • bullseye_28:0.11%
  • bullseye_29:0.11%
  • bullseye_30:19.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 12.5 0.6 30.3sec 28.8sec 8.55% 10.83% 0.6(0.7) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.44%
  • lock_and_load_2:4.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 35.7 13.7 11.3sec 8.1sec 41.10% 49.53% 13.7(13.7) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:41.10%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 76.7sec 0.0sec 14.69% 14.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 3.4 0.0 138.9sec 142.7sec 12.66% 14.11% 0.0(0.0) 3.3

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:12.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 3.4 0.0 138.9sec 142.7sec 12.66% 17.94% 0.0(0.0) 3.3

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:12.66%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Rothlandra
aimed_shot Focus 116.2 4541.3 39.1 39.1 11148.0
barrage Focus 19.3 1158.2 60.0 60.0 28108.4
marked_shot Focus 36.9 1106.5 30.0 30.0 49090.4
windburst Focus 16.8 336.8 20.0 21.3 24690.4
Resource Gains Type Count Total Average Overflow
arcane_torrent Focus 4.83 71.77 (1.02%) 14.85 0.74 1.02%
sidewinders Focus 45.14 2111.82 (29.87%) 46.79 144.99 6.42%
focus_regen Focus 1435.34 4886.79 (69.12%) 3.40 408.54 7.72%
Resource RPS-Gain RPS-Loss
Focus 17.66 17.84
Combat End Resource Mean Min Max
Focus 77.90 0.61 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 6.2%

Procs

Count Interval
starved: barrage 108.7 5.2sec
lock_and_load 13.1 28.8sec
no_vuln_aimed_shot 11.0 28.4sec
no_vuln_marked_shot 5.4 58.0sec
marking_targets 49.4 8.1sec
wasted_marking_targets 13.7 27.5sec

Statistics & Data Analysis

Fight Length
Sample Data Rothlandra Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Rothlandra Damage Per Second
Count 9999
Mean 449461.98
Minimum 363785.70
Maximum 566324.87
Spread ( max - min ) 202539.17
Range [ ( max - min ) / 2 * 100% ] 22.53%
Standard Deviation 32731.9205
5th Percentile 403150.36
95th Percentile 511119.77
( 95th Percentile - 5th Percentile ) 107969.41
Mean Distribution
Standard Deviation 327.3356
95.00% Confidence Intervall ( 448820.42 - 450103.55 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 203
0.1% Error 20372
0.1 Scale Factor Error with Delta=300 9145904
0.05 Scale Factor Error with Delta=300 36583616
0.01 Scale Factor Error with Delta=300 914590412
Priority Target DPS
Sample Data Rothlandra Priority Target Damage Per Second
Count 9999
Mean 270529.49
Minimum 231688.96
Maximum 312105.61
Spread ( max - min ) 80416.65
Range [ ( max - min ) / 2 * 100% ] 14.86%
Standard Deviation 10691.0794
5th Percentile 253361.97
95th Percentile 288697.48
( 95th Percentile - 5th Percentile ) 35335.51
Mean Distribution
Standard Deviation 106.9161
95.00% Confidence Intervall ( 270319.94 - 270739.04 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 59
0.1% Error 5999
0.1 Scale Factor Error with Delta=300 975723
0.05 Scale Factor Error with Delta=300 3902894
0.01 Scale Factor Error with Delta=300 97572352
DPS(e)
Sample Data Rothlandra Damage Per Second (Effective)
Count 9999
Mean 449461.98
Minimum 363785.70
Maximum 566324.87
Spread ( max - min ) 202539.17
Range [ ( max - min ) / 2 * 100% ] 22.53%
Damage
Sample Data Rothlandra Damage
Count 9999
Mean 178749039.76
Minimum 139111292.09
Maximum 219268065.11
Spread ( max - min ) 80156773.02
Range [ ( max - min ) / 2 * 100% ] 22.42%
DTPS
Sample Data Rothlandra Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Rothlandra Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Rothlandra Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Rothlandra Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Rothlandra Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Rothlandra Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RothlandraTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Rothlandra Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 0.98 auto_shot
8 4.83 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
0.00 blood_fury
0.00 berserking
9 0.02 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
A 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
B 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
C 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
D 12.35 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
E 6.02 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
F 17.63 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
G 0.03 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
H 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
I 11.54 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
J 0.50 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
K 21.67 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
L 34.08 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
M 77.88 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
N 9.69 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
O 1.17 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
P 29.85 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
Q 9.07 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
R 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
S 2.47 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
T 0.95 trueshot
U 1.48 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
V 3.10 marked_shot
W 1.27 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
X 0.93 barrage
Y 7.11 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 1.61 sidewinders
a 0.29 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
b 0.76 marked_shot
c 0.01 windburst
d 1.32 aimed_shot,if=execute_time<debuff.vulnerability.remains
e 0.66 sidewinders
f 0.20 aimed_shot
0.00 arcane_shot

Sample Sequence

04567TXYaWYZVY8YZLVYUVaYMPLLEKPFKMMMPKMMMPELNFILLKMLPKDMRPFLLLNIMMDQPKFMMMQQ8PKDMPLLFKMIMMDPKMMMFMSMMMILLKDMIKMMMMPKFMMMIDMQPLKMMFMMMPEKM8MPMMQFPKDQQQPKMMQPFNMDQQPKMMPKFMLDPNMMLQQQPKFDMPKMMMQPM8MSLDFMILKMMIKMMMQPNDFIMMLQMPLLNMIEFLNPLLNPMDFMPLLLNMMPL8LNDFMPLLKMPbdd

Sample Sequence Table

time name target resources buffs
Pre flask Rothlandra 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Rothlandra 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus rapid_killing, trueshot, potion_of_deadly_grace
0:02.077 aimed_shot Fluffy_Pillow 111.3/150: 74% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:02.982 aimed_shot Fluffy_Pillow 81.4/150: 54% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.886 aimed_shot Fluffy_Pillow 101.5/150: 68% focus bloodlust, lock_and_load, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.640 aimed_shot Fluffy_Pillow 118.2/150: 79% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:05.545 sidewinders Fluffy_Pillow 88.3/150: 59% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:06.301 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:07.055 aimed_shot Fluffy_Pillow 136.7/150: 91% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:07.962 arcane_torrent Fluffy_Pillow 100.2/150: 67% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:07.962 aimed_shot Fluffy_Pillow 115.2/150: 77% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:08.864 sidewinders Fluffy_Pillow 85.2/150: 57% focus bloodlust, rapid_killing, trueshot, potion_of_deadly_grace
0:09.619 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:10.524 marked_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:11.279 aimed_shot Fluffy_Pillow 86.9/150: 58% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:12.034 sidewinders Fluffy_Pillow 103.6/150: 69% focus bloodlust, raid_movement, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:12.789 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.545 aimed_shot Fluffy_Pillow 136.8/150: 91% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.450 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.356 aimed_shot Fluffy_Pillow 68.0/150: 45% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.620 sidewinders Fluffy_Pillow 38.0/150: 25% focus bloodlust, marking_targets, potion_of_deadly_grace
0:17.569 aimed_shot Fluffy_Pillow 103.1/150: 69% focus bloodlust, potion_of_deadly_grace
0:18.833 aimed_shot Fluffy_Pillow 73.1/150: 49% focus bloodlust, potion_of_deadly_grace
0:20.005 barrage Fluffy_Pillow 91.7/150: 61% focus bloodlust, raid_movement, potion_of_deadly_grace
0:22.210 marked_shot Fluffy_Pillow 66.7/150: 44% focus bloodlust, raid_movement, potion_of_deadly_grace
0:23.160 Waiting 0.100 sec 51.7/150: 34% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:23.260 sidewinders Fluffy_Pillow 53.3/150: 36% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:24.210 windburst Fluffy_Pillow 118.4/150: 79% focus bloodlust, potion_of_deadly_grace
0:25.159 marked_shot Fluffy_Pillow 113.5/150: 76% focus bloodlust, marking_targets, potion_of_deadly_grace
0:26.108 aimed_shot Fluffy_Pillow 98.5/150: 66% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.372 aimed_shot Fluffy_Pillow 68.6/150: 46% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.322 Waiting 0.900 sec 83.6/150: 56% focus bloodlust, raid_movement, marking_targets
0:29.222 aimed_shot Fluffy_Pillow 97.9/150: 65% focus bloodlust, marking_targets
0:30.487 sidewinders Fluffy_Pillow 68.0/150: 45% focus bloodlust, marking_targets
0:31.437 marked_shot Fluffy_Pillow 133.0/150: 89% focus bloodlust
0:32.386 aimed_shot Fluffy_Pillow 118.1/150: 79% focus bloodlust
0:33.652 aimed_shot Fluffy_Pillow 88.2/150: 59% focus bloodlust
0:34.917 aimed_shot Fluffy_Pillow 58.2/150: 39% focus bloodlust
0:36.181 Waiting 3.300 sec 28.3/150: 19% focus bloodlust
0:39.481 sidewinders Fluffy_Pillow 80.6/150: 54% focus bloodlust, marking_targets
0:40.431 barrage Fluffy_Pillow 145.7/150: 97% focus bloodlust, bullseye(5)
0:42.538 aimed_shot Fluffy_Pillow 113.2/150: 75% focus bullseye(5)
0:44.004 Waiting 0.100 sec 131.1/150: 87% focus raid_movement, bullseye(5)
0:44.104 marked_shot Fluffy_Pillow 132.3/150: 88% focus raid_movement, bullseye(5)
0:45.337 windburst Fluffy_Pillow 117.4/150: 78% focus bullseye(5), marking_targets
0:46.570 sidewinders Fluffy_Pillow 112.4/150: 75% focus marking_targets
0:47.804 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
0:49.447 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
0:50.679 marked_shot Fluffy_Pillow 115.1/150: 77% focus raid_movement
0:51.912 Waiting 1.700 sec 100.1/150: 67% focus raid_movement
0:53.612 aimed_shot Fluffy_Pillow 120.9/150: 81% focus
0:55.255 Waiting 0.700 sec 90.9/150: 61% focus marking_targets
0:55.955 aimed_shot Fluffy_Pillow 99.5/150: 66% focus marking_targets
0:57.598 sidewinders Fluffy_Pillow 69.5/150: 46% focus marking_targets
0:58.832 marked_shot Fluffy_Pillow 134.6/150: 90% focus
1:00.066 Waiting 0.200 sec 119.6/150: 80% focus raid_movement
1:00.266 barrage Fluffy_Pillow 122.0/150: 81% focus raid_movement
1:02.993 aimed_shot Fluffy_Pillow 95.3/150: 64% focus
1:04.638 potion Fluffy_Pillow 65.4/150: 44% focus marking_targets
1:04.638 Waiting 0.300 sec 65.4/150: 44% focus marking_targets, potion_of_deadly_grace
1:04.938 sidewinders Fluffy_Pillow 69.0/150: 46% focus marking_targets, potion_of_deadly_grace
1:06.392 windburst Fluffy_Pillow 136.8/150: 91% focus potion_of_deadly_grace
1:07.799 aimed_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
1:09.441 aimed_shot Fluffy_Pillow 100.0/150: 67% focus potion_of_deadly_grace
1:11.084 aimed_shot Fluffy_Pillow 70.1/150: 47% focus potion_of_deadly_grace
1:12.727 Waiting 0.100 sec 40.1/150: 27% focus potion_of_deadly_grace
1:12.827 marked_shot Fluffy_Pillow 41.3/150: 28% focus potion_of_deadly_grace
1:14.059 Waiting 1.800 sec 26.4/150: 18% focus potion_of_deadly_grace
1:15.859 sidewinders Fluffy_Pillow 48.3/150: 32% focus potion_of_deadly_grace
1:17.093 Waiting 0.100 sec 113.4/150: 76% focus raid_movement, potion_of_deadly_grace
1:17.193 aimed_shot Fluffy_Pillow 114.6/150: 76% focus potion_of_deadly_grace
1:18.838 aimed_shot Fluffy_Pillow 84.7/150: 56% focus potion_of_deadly_grace
1:20.072 Waiting 0.200 sec 99.7/150: 66% focus raid_movement, potion_of_deadly_grace
1:20.272 barrage Fluffy_Pillow 102.2/150: 68% focus raid_movement, potion_of_deadly_grace
1:23.146 Waiting 0.500 sec 77.2/150: 51% focus raid_movement, potion_of_deadly_grace
1:23.646 aimed_shot Fluffy_Pillow 83.3/150: 56% focus marking_targets, potion_of_deadly_grace
1:25.290 sidewinders Fluffy_Pillow 53.4/150: 36% focus marking_targets, potion_of_deadly_grace
1:26.523 marked_shot Fluffy_Pillow 118.4/150: 79% focus marking_targets, potion_of_deadly_grace
1:27.756 windburst Fluffy_Pillow 103.5/150: 69% focus marking_targets, potion_of_deadly_grace
1:29.029 aimed_shot Fluffy_Pillow 99.0/150: 66% focus marking_targets, potion_of_deadly_grace
1:30.673 aimed_shot Fluffy_Pillow 69.1/150: 46% focus marking_targets, potion_of_deadly_grace
1:32.004 Waiting 1.200 sec 85.3/150: 57% focus raid_movement, lock_and_load(2), marking_targets, potion_of_deadly_grace
1:33.204 aimed_shot Fluffy_Pillow 100.0/150: 67% focus lock_and_load(2), marking_targets, potion_of_deadly_grace
1:34.436 Waiting 0.600 sec 115.0/150: 77% focus lock_and_load, marking_targets, potion_of_deadly_grace
1:35.036 aimed_shot Fluffy_Pillow 122.3/150: 82% focus lock_and_load, marking_targets
1:36.270 aimed_shot Fluffy_Pillow 137.4/150: 92% focus marking_targets
1:37.915 arcane_torrent Fluffy_Pillow 100.1/150: 67% focus marking_targets
1:37.962 sidewinders Fluffy_Pillow 115.6/150: 77% focus marking_targets
1:39.195 marked_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(5), marking_targets
1:40.427 barrage Fluffy_Pillow 135.0/150: 90% focus bullseye(10), marking_targets
1:43.171 aimed_shot Fluffy_Pillow 108.5/150: 72% focus bullseye(10), marking_targets
1:44.815 sidewinders Fluffy_Pillow 78.6/150: 52% focus bullseye(10), marking_targets
1:46.050 aimed_shot Fluffy_Pillow 143.6/150: 96% focus
1:47.694 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
1:48.929 Waiting 0.300 sec 115.1/150: 77% focus raid_movement
1:49.229 windburst Fluffy_Pillow 118.8/150: 79% focus
1:50.461 marked_shot Fluffy_Pillow 133.8/150: 89% focus raid_movement
1:51.692 Waiting 1.900 sec 118.8/150: 79% focus raid_movement
1:53.592 aimed_shot Fluffy_Pillow 142.0/150: 95% focus
1:55.237 Waiting 0.400 sec 100.1/150: 67% focus
1:55.637 sidewinders Fluffy_Pillow 105.0/150: 70% focus
1:56.872 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
1:58.517 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
2:00.161 Waiting 0.100 sec 70.1/150: 47% focus
2:00.261 barrage Fluffy_Pillow 71.4/150: 48% focus
2:03.001 Waiting 1.000 sec 44.8/150: 30% focus
2:04.001 sidewinders Fluffy_Pillow 57.0/150: 38% focus raid_movement, marking_targets
2:05.402 marked_shot Fluffy_Pillow 124.1/150: 83% focus
2:06.635 aimed_shot Fluffy_Pillow 109.1/150: 73% focus lock_and_load(2)
2:07.868 aimed_shot Fluffy_Pillow 124.2/150: 83% focus lock_and_load
2:09.101 aimed_shot Fluffy_Pillow 139.2/150: 93% focus
2:10.744 windburst Fluffy_Pillow 100.0/150: 67% focus
2:11.978 aimed_shot Fluffy_Pillow 95.1/150: 63% focus marking_targets
2:13.621 trueshot Fluffy_Pillow 115.1/150: 77% focus lock_and_load, marking_targets
2:13.621 aimed_shot Fluffy_Pillow 115.1/150: 77% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:14.503 aimed_shot Fluffy_Pillow 130.2/150: 87% focus marking_targets, rapid_killing, trueshot
2:15.678 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
2:16.853 sidewinders Fluffy_Pillow 70.2/150: 47% focus marking_targets, rapid_killing, trueshot
2:17.734 aimed_shot Fluffy_Pillow 135.2/150: 90% focus rapid_killing, trueshot
2:18.908 aimed_shot Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot
2:20.005 marked_shot Fluffy_Pillow 118.8/150: 79% focus raid_movement, rapid_killing, trueshot
2:20.886 barrage Fluffy_Pillow 103.9/150: 69% focus rapid_killing, trueshot
2:22.893 aimed_shot Fluffy_Pillow 78.1/150: 52% focus rapid_killing, trueshot
2:24.066 sidewinders Fluffy_Pillow 48.2/150: 32% focus marking_targets, rapid_killing, trueshot
2:24.948 marked_shot Fluffy_Pillow 113.2/150: 75% focus marking_targets, rapid_killing, trueshot
2:25.831 aimed_shot Fluffy_Pillow 98.3/150: 66% focus marking_targets, rapid_killing, trueshot
2:27.005 aimed_shot Fluffy_Pillow 118.4/150: 79% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:27.887 aimed_shot Fluffy_Pillow 133.4/150: 89% focus marking_targets, rapid_killing, trueshot
2:29.061 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
2:30.703 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
2:32.096 marked_shot Fluffy_Pillow 137.1/150: 91% focus
2:33.330 windburst Fluffy_Pillow 122.1/150: 81% focus
2:34.563 aimed_shot Fluffy_Pillow 117.2/150: 78% focus
2:36.004 Waiting 1.200 sec 134.8/150: 90% focus raid_movement
2:37.204 aimed_shot Fluffy_Pillow 149.4/150: 100% focus
2:38.849 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
2:40.082 sidewinders Fluffy_Pillow 150.0/150: 100% focus
2:41.316 barrage Fluffy_Pillow 150.0/150: 100% focus
2:43.979 aimed_shot Fluffy_Pillow 122.5/150: 82% focus
2:45.622 Waiting 0.500 sec 92.5/150: 62% focus marking_targets
2:46.122 aimed_shot Fluffy_Pillow 98.6/150: 66% focus marking_targets
2:47.765 sidewinders Fluffy_Pillow 68.7/150: 46% focus marking_targets
2:48.999 aimed_shot Fluffy_Pillow 133.7/150: 89% focus
2:50.232 marked_shot Fluffy_Pillow 148.8/150: 99% focus raid_movement, marking_targets
2:51.463 Waiting 1.200 sec 133.8/150: 89% focus raid_movement, marking_targets
2:52.663 aimed_shot Fluffy_Pillow 148.4/150: 99% focus marking_targets
2:54.307 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
2:55.540 windburst Fluffy_Pillow 150.0/150: 100% focus marking_targets
2:56.773 aimed_shot Fluffy_Pillow 130.0/150: 87% focus marking_targets
2:58.417 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets
3:00.062 aimed_shot Fluffy_Pillow 70.1/150: 47% focus marking_targets
3:01.706 sidewinders Fluffy_Pillow 40.2/150: 27% focus marking_targets
3:02.941 barrage Fluffy_Pillow 105.3/150: 70% focus
3:05.648 marked_shot Fluffy_Pillow 78.3/150: 52% focus
3:06.880 Waiting 0.100 sec 63.3/150: 42% focus
3:06.980 aimed_shot Fluffy_Pillow 64.5/150: 43% focus
3:08.215 arcane_torrent Fluffy_Pillow 79.6/150: 53% focus raid_movement
3:08.215 Waiting 1.000 sec 94.6/150: 63% focus raid_movement
3:09.215 aimed_shot Fluffy_Pillow 106.8/150: 71% focus
3:10.857 sidewinders Fluffy_Pillow 76.8/150: 51% focus
3:12.091 aimed_shot Fluffy_Pillow 141.9/150: 95% focus
3:13.735 aimed_shot Fluffy_Pillow 100.1/150: 67% focus
3:15.378 aimed_shot Fluffy_Pillow 70.1/150: 47% focus
3:17.021 windburst Fluffy_Pillow 40.2/150: 27% focus
3:18.256 sidewinders Fluffy_Pillow 35.2/150: 23% focus marking_targets
3:19.489 marked_shot Fluffy_Pillow 100.3/150: 67% focus
3:20.725 Waiting 2.000 sec 85.3/150: 57% focus raid_movement, lock_and_load(2), marking_targets
3:22.725 barrage Fluffy_Pillow 109.7/150: 73% focus raid_movement, lock_and_load(2), marking_targets
3:25.689 aimed_shot Fluffy_Pillow 85.9/150: 57% focus lock_and_load(2), marking_targets
3:26.921 aimed_shot Fluffy_Pillow 100.9/150: 67% focus lock_and_load, marking_targets
3:28.153 aimed_shot Fluffy_Pillow 116.0/150: 77% focus marking_targets
3:29.795 sidewinders Fluffy_Pillow 86.0/150: 57% focus marking_targets
3:31.028 marked_shot Fluffy_Pillow 150.0/150: 100% focus
3:32.261 aimed_shot Fluffy_Pillow 135.0/150: 90% focus
3:33.904 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
3:35.548 Waiting 0.500 sec 70.1/150: 47% focus
3:36.048 aimed_shot Fluffy_Pillow 76.2/150: 51% focus marking_targets
3:37.692 sidewinders Fluffy_Pillow 46.3/150: 31% focus marking_targets
3:38.924 windburst Fluffy_Pillow 111.3/150: 74% focus bullseye(5), lock_and_load(2), marking_targets
3:40.157 Waiting 0.700 sec 126.3/150: 84% focus raid_movement, bullseye(5), lock_and_load(2), marking_targets
3:40.857 marked_shot Fluffy_Pillow 134.9/150: 90% focus raid_movement, bullseye(5), lock_and_load(2), marking_targets
3:42.091 aimed_shot Fluffy_Pillow 119.9/150: 80% focus bullseye(5), lock_and_load(2), marking_targets
3:43.325 barrage Fluffy_Pillow 135.0/150: 90% focus bullseye(5), lock_and_load, marking_targets
3:45.984 Waiting 0.900 sec 107.4/150: 72% focus lock_and_load, marking_targets
3:46.884 aimed_shot Fluffy_Pillow 118.4/150: 79% focus lock_and_load, marking_targets
3:48.117 aimed_shot Fluffy_Pillow 133.5/150: 89% focus marking_targets
3:49.760 sidewinders Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:50.992 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load
3:52.224 Waiting 1.400 sec 135.0/150: 90% focus raid_movement, lock_and_load, marking_targets
3:53.624 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:54.856 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:56.090 Waiting 1.200 sec 150.0/150: 100% focus raid_movement, marking_targets
3:57.290 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:58.523 marked_shot Fluffy_Pillow 150.0/150: 100% focus
3:59.754 windburst Fluffy_Pillow 135.0/150: 90% focus
4:01.233 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
4:02.876 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
4:04.518 barrage Fluffy_Pillow 70.1/150: 47% focus marking_targets
4:07.287 sidewinders Fluffy_Pillow 43.9/150: 29% focus bullseye(20), marking_targets
4:08.520 marked_shot Fluffy_Pillow 108.9/150: 73% focus bullseye(25), marking_targets
4:09.754 aimed_shot Fluffy_Pillow 94.0/150: 63% focus bullseye(30), marking_targets
4:11.397 aimed_shot Fluffy_Pillow 64.0/150: 43% focus bullseye(30), marking_targets
4:12.633 Waiting 0.800 sec 79.1/150: 53% focus raid_movement, bullseye(30), marking_targets
4:13.433 aimed_shot Fluffy_Pillow 88.9/150: 59% focus bullseye(30), marking_targets
4:15.075 aimed_shot Fluffy_Pillow 108.9/150: 73% focus lock_and_load, marking_targets
4:16.308 aimed_shot Fluffy_Pillow 123.9/150: 83% focus marking_targets
4:17.952 aimed_shot Fluffy_Pillow 94.0/150: 63% focus marking_targets
4:19.594 sidewinders Fluffy_Pillow 64.0/150: 43% focus marking_targets
4:20.828 marked_shot Fluffy_Pillow 129.1/150: 86% focus raid_movement
4:22.060 Waiting 1.600 sec 114.1/150: 76% focus raid_movement
4:23.660 windburst Fluffy_Pillow 133.6/150: 89% focus marking_targets
4:24.894 barrage Fluffy_Pillow 128.7/150: 86% focus marking_targets
4:27.522 aimed_shot Fluffy_Pillow 100.7/150: 67% focus marking_targets
4:28.755 Waiting 0.200 sec 115.8/150: 77% focus raid_movement, marking_targets
4:28.955 sidewinders Fluffy_Pillow 118.2/150: 79% focus raid_movement, marking_targets
4:30.190 marked_shot Fluffy_Pillow 150.0/150: 100% focus
4:31.423 aimed_shot Fluffy_Pillow 135.0/150: 90% focus lock_and_load(2)
4:32.656 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load
4:33.891 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
4:35.534 Waiting 0.200 sec 100.0/150: 67% focus
4:35.734 aimed_shot Fluffy_Pillow 102.5/150: 68% focus
4:37.378 Waiting 0.200 sec 72.5/150: 48% focus
4:37.578 sidewinders Fluffy_Pillow 75.0/150: 50% focus
4:38.810 aimed_shot Fluffy_Pillow 140.0/150: 93% focus bullseye(5)
4:40.454 arcane_torrent Fluffy_Pillow 100.1/150: 67% focus bullseye(5), marking_targets
4:40.454 aimed_shot Fluffy_Pillow 115.1/150: 77% focus bullseye(5), marking_targets
4:42.098 Waiting 1.500 sec 85.1/150: 57% focus bullseye(5), marking_targets
4:43.598 trueshot Fluffy_Pillow 103.4/150: 69% focus marking_targets
4:43.598 aimed_shot Fluffy_Pillow 103.4/150: 69% focus marking_targets, rapid_killing, trueshot
4:44.479 Waiting 0.200 sec 118.5/150: 79% focus raid_movement, marking_targets, rapid_killing, trueshot
4:44.679 barrage Fluffy_Pillow 121.9/150: 81% focus raid_movement, marking_targets, rapid_killing, trueshot
4:46.864 windburst Fluffy_Pillow 99.2/150: 66% focus marking_targets, rapid_killing, trueshot
4:47.748 aimed_shot Fluffy_Pillow 94.3/150: 63% focus marking_targets, rapid_killing, trueshot
4:48.922 sidewinders Fluffy_Pillow 64.4/150: 43% focus marking_targets, rapid_killing, trueshot
4:49.803 aimed_shot Fluffy_Pillow 129.4/150: 86% focus rapid_killing, trueshot
4:50.686 marked_shot Fluffy_Pillow 144.5/150: 96% focus raid_movement, rapid_killing, trueshot
4:51.568 Waiting 2.100 sec 129.6/150: 86% focus raid_movement, rapid_killing, trueshot
4:53.668 aimed_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, rapid_killing, trueshot
4:54.844 aimed_shot Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
4:56.020 sidewinders Fluffy_Pillow 70.2/150: 47% focus marking_targets, rapid_killing, trueshot
4:56.902 marked_shot Fluffy_Pillow 135.3/150: 90% focus rapid_killing, trueshot
4:57.784 aimed_shot Fluffy_Pillow 120.3/150: 80% focus rapid_killing, trueshot
4:58.958 aimed_shot Fluffy_Pillow 88.6/150: 59% focus
5:00.192 Waiting 1.000 sec 103.7/150: 69% focus raid_movement, marking_targets
5:01.192 aimed_shot Fluffy_Pillow 115.9/150: 77% focus marking_targets
5:02.836 Waiting 0.100 sec 85.9/150: 57% focus marking_targets
5:02.936 aimed_shot Fluffy_Pillow 87.2/150: 58% focus marking_targets
5:04.580 sidewinders Fluffy_Pillow 57.2/150: 38% focus marking_targets
5:05.812 marked_shot Fluffy_Pillow 122.2/150: 81% focus
5:07.043 barrage Fluffy_Pillow 107.3/150: 72% focus
5:09.720 windburst Fluffy_Pillow 79.9/150: 53% focus bullseye(30)
5:10.954 sidewinders Fluffy_Pillow 75.0/150: 50% focus bullseye(30)
5:12.190 aimed_shot Fluffy_Pillow 140.1/150: 93% focus bullseye(30)
5:13.833 aimed_shot Fluffy_Pillow 100.0/150: 67% focus bullseye(30), marking_targets
5:15.477 Waiting 0.500 sec 70.1/150: 47% focus bullseye(30), marking_targets
5:15.977 aimed_shot Fluffy_Pillow 76.2/150: 51% focus marking_targets
5:17.211 aimed_shot Fluffy_Pillow 91.3/150: 61% focus marking_targets
5:18.855 Waiting 0.100 sec 61.3/150: 41% focus bullseye, marking_targets
5:18.955 aimed_shot Fluffy_Pillow 62.5/150: 42% focus bullseye, marking_targets
5:20.599 sidewinders Fluffy_Pillow 32.6/150: 22% focus bullseye(3), marking_targets
5:21.835 aimed_shot Fluffy_Pillow 97.7/150: 65% focus bullseye(5)
5:23.478 aimed_shot Fluffy_Pillow 67.7/150: 45% focus bullseye(6), marking_targets
5:25.122 Waiting 0.500 sec 37.8/150: 25% focus bullseye(8), marking_targets
5:25.622 marked_shot Fluffy_Pillow 43.9/150: 29% focus bullseye(9), marking_targets
5:26.856 Waiting 1.800 sec 28.9/150: 19% focus bullseye(10), marking_targets
5:28.656 aimed_shot Fluffy_Pillow 50.9/150: 34% focus bullseye(11), marking_targets
5:30.298 Waiting 0.100 sec 20.9/150: 14% focus bullseye(12), marking_targets
5:30.398 sidewinders Fluffy_Pillow 22.2/150: 15% focus bullseye(12), marking_targets
5:31.632 barrage Fluffy_Pillow 87.2/150: 58% focus bullseye(14)
5:34.354 windburst Fluffy_Pillow 60.4/150: 40% focus bullseye(30)
5:35.587 aimed_shot Fluffy_Pillow 55.5/150: 37% focus bullseye(30), marking_targets
5:37.231 Waiting 0.700 sec 25.5/150: 17% focus bullseye(30), marking_targets
5:37.931 marked_shot Fluffy_Pillow 34.1/150: 23% focus bullseye(30), marking_targets
5:39.162 sidewinders Fluffy_Pillow 19.1/150: 13% focus bullseye(30), marking_targets
5:40.397 aimed_shot Fluffy_Pillow 84.1/150: 56% focus bullseye(30)
5:42.040 aimed_shot Fluffy_Pillow 54.2/150: 36% focus bullseye(30)
5:43.682 Waiting 0.500 sec 24.2/150: 16% focus bullseye(30)
5:44.182 marked_shot Fluffy_Pillow 30.3/150: 20% focus bullseye(30)
5:45.418 Waiting 4.000 sec 15.4/150: 10% focus bullseye(30)
5:49.418 sidewinders Fluffy_Pillow 64.2/150: 43% focus bullseye(30)
5:50.652 aimed_shot Fluffy_Pillow 129.3/150: 86% focus bullseye(30)
5:52.294 barrage Fluffy_Pillow 99.3/150: 66% focus bullseye(30), marking_targets
5:54.877 Waiting 0.500 sec 70.8/150: 47% focus bullseye(30), marking_targets
5:55.377 windburst Fluffy_Pillow 76.9/150: 51% focus bullseye(30), marking_targets
5:56.815 aimed_shot Fluffy_Pillow 74.5/150: 50% focus bullseye(30), marking_targets
5:58.460 Waiting 0.100 sec 44.5/150: 30% focus bullseye(30), marking_targets
5:58.560 sidewinders Fluffy_Pillow 45.7/150: 30% focus bullseye(30), marking_targets
6:00.036 aimed_shot Fluffy_Pillow 113.8/150: 76% focus bullseye(30)
6:01.680 aimed_shot Fluffy_Pillow 133.8/150: 89% focus bullseye(30), lock_and_load
6:02.914 aimed_shot Fluffy_Pillow 148.9/150: 99% focus bullseye(30), marking_targets
6:04.147 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, bullseye(30), marking_targets
6:05.379 aimed_shot Fluffy_Pillow 135.0/150: 90% focus bullseye(30), marking_targets
6:07.023 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30), marking_targets
6:08.666 sidewinders Fluffy_Pillow 70.1/150: 47% focus bullseye(30), marking_targets
6:09.898 aimed_shot Fluffy_Pillow 135.1/150: 90% focus bullseye(30)
6:11.541 arcane_torrent Fluffy_Pillow 100.0/150: 67% focus bullseye(30)
6:11.541 aimed_shot Fluffy_Pillow 115.0/150: 77% focus bullseye(30)
6:13.185 Waiting 0.500 sec 85.1/150: 57% focus bullseye(30)
6:13.685 marked_shot Fluffy_Pillow 91.2/150: 61% focus bullseye(30)
6:14.918 barrage Fluffy_Pillow 76.3/150: 51% focus bullseye(30)
6:17.507 windburst Fluffy_Pillow 47.8/150: 32% focus bullseye(30)
6:18.741 Waiting 0.600 sec 42.9/150: 29% focus bullseye(30)
6:19.341 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(30)
6:20.576 sidewinders Fluffy_Pillow 65.3/150: 44% focus raid_movement, bullseye(30), marking_targets
6:21.811 Waiting 0.100 sec 130.3/150: 87% focus bullseye(30)
6:21.911 aimed_shot Fluffy_Pillow 131.6/150: 88% focus bullseye(30)
6:23.555 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(30)
6:25.197 Waiting 0.300 sec 70.1/150: 47% focus bullseye(30)
6:25.497 marked_shot Fluffy_Pillow 73.8/150: 49% focus bullseye(30), marking_targets
6:26.730 aimed_shot Fluffy_Pillow 58.8/150: 39% focus bullseye(30), marking_targets
6:28.374 sidewinders Fluffy_Pillow 28.9/150: 19% focus bullseye(30), marking_targets
6:29.607 marked_shot Fluffy_Pillow 93.9/150: 63% focus bullseye(30)
6:30.839 aimed_shot Fluffy_Pillow 78.9/150: 53% focus bullseye(30)
6:32.481 Waiting 0.100 sec 49.0/150: 33% focus bullseye(30)
6:32.581 aimed_shot Fluffy_Pillow 50.2/150: 33% focus bullseye(30)
6:34.224 Waiting 1.200 sec 20.2/150: 13% focus bullseye(30)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6228 6228 0
Agility 27150 25785 15526 (10401)
Stamina 34002 34002 21669
Intellect 6009 6009 0
Spirit 2 2 0
Health 2040120 2040120 0
Focus 150 150 0
Crit 23.12% 23.12% 2493
Haste 22.01% 22.01% 7152
Damage / Heal Versatility 1.02% 1.02% 407
Attack Power 27150 25785 0
Mastery 19.68% 19.68% 8221
Armor 2597 2597 2597
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 864.00
Local Head Greyed Dragonscale Coif
ilevel: 855, stats: { 341 Armor, +2038 Sta, +1359 AgiInt, +751 Mastery, +579 Crit }
Local Neck Hatecoil Commander's Amulet
ilevel: 850, stats: { +1094 Sta, +1101 Haste, +734 Mastery }
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Chest Bramblemail Hauberk
ilevel: 850, stats: { 414 Armor, +1297 AgiInt, +1945 Sta, +932 Haste, +372 Mastery }
Local Waist Belt of Mighty Links
ilevel: 865, stats: { 244 Armor, +1119 AgiInt, +1678 Sta, +673 Mastery, +362 Haste }
Local Legs Tempered Seaborne Leggings
ilevel: 850, stats: { 362 Armor, +1945 Sta, +1297 AgiInt, +820 Haste, +484 Crit }
Local Feet Ullr's Feather Snowshoes
ilevel: 895, stats: { 327 Armor, +2219 Sta, +1479 Agi, +662 Crit, +496 Mastery }
Local Wrists Assorted Dragonscale Bracers
ilevel: 870, stats: { 193 Armor, +1319 Sta, +879 AgiInt, +548 Haste, +242 Mastery }
Local Hands Gauntlets of Malevolent Intent
ilevel: 865, stats: { 271 Armor, +1678 Sta, +1119 AgiInt, +628 Haste, +407 Vers }
Local Finger1 Arch-Druid's Tainted Seal
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: { +150 Mastery }
Local Finger2 Ring of Collapsing Futures
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Haste }, enchant: { +150 Mastery }
Local Trinket1 Deteriorated Construct Core
ilevel: 875, stats: { +1557 AgiInt }
Local Trinket2 Three-Toed Rabbit Foot
ilevel: 880, stats: { +1631 Agi, +1043 Haste }
Local Back Drape of the Raven Lord
ilevel: 860, stats: { 135 Armor, +801 StrAgiInt, +1201 Sta, +490 Mastery, +272 Haste }, enchant: { +150 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 889, weapon: { 10053 - 10055, 3 }, stats: { +1865 Agi, +2798 Sta, +768 Crit, +737 Mastery }, relics: { +45 ilevels, +46 ilevels, +48 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Rothlandra"
origin="https://us.api.battle.net/wow/character/thrall/Rothlandra/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/85/161015381-avatar.jpg"
level=110
race=blood_elf
role=attack
position=ranged_back
professions=mining=266/herbalism=312
talents=1113121
artifact=55:0:0:0:0:307:1:308:1:310:1:312:3:313:3:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1477/3336
neck=hatecoil_commanders_amulet,id=134492,bonus_id=1727/1502/3336
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=drape_of_the_raven_lord,id=136770,bonus_id=1727/1512/3337,enchant=150agi
chest=bramblemail_hauberk,id=139084,bonus_id=3474/1512/3336
wrists=assorted_dragonscale_bracers,id=141433,bonus_id=3466/1482/3336
hands=gauntlets_of_malevolent_intent,id=139213,bonus_id=1805/1487
waist=belt_of_mighty_links,id=137456,bonus_id=3413/1517/3337
legs=tempered_seaborne_leggings,id=133769,bonus_id=3410/1502/3336
feet=ullrs_feather_snowshoes,id=137033,bonus_id=1811/3458
finger1=archdruids_tainted_seal,id=134487,bonus_id=3410/1502/3336,enchant=150mastery
finger2=ring_of_collapsing_futures,id=142173,bonus_id=3453/1472,enchant=150mastery
trinket1=deteriorated_construct_core,id=142165,bonus_id=3453/1487/3337
trinket2=threetoed_rabbit_foot,id=134203,bonus_id=3474/604/1542/3337
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=142194/142180/141256/0,relic_id=3452:1472/3453:1472/3474:1527:3337/0

# Gear Summary
# gear_ilvl=864.27
# gear_agility=15526
# gear_stamina=21669
# gear_crit_rating=2493
# gear_haste_rating=7152
# gear_mastery_rating=8221
# gear_versatility_rating=407
# gear_armor=2597
summon_pet=cat

Sarkul

Sarkul : 464899 dps, 278182 dps to main target

  • Race: Orc
  • Class: Hunter
  • Spec: Marksmanship
  • Level: 110
  • Role: Attack
  • Position: ranged_back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
464899.4 464899.4 640.7 / 0.138% 122376.1 / 26.3% 28477.6
RPS Out RPS In Primary Resource Waiting APM Active Skill
16.2 16.2 Focus 13.51% 35.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Sarkul/advanced
Talents
  • 15: Lone Wolf (Marksmanship Hunter)
  • 30: Lock and Load (Marksmanship Hunter)
  • 45: Trailblazer
  • 60: Patient Sniper (Marksmanship Hunter)
  • 75: Binding Shot
  • 90: Barrage
  • 100: Sidewinders (Marksmanship Hunter)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • engineering: 709
Scale Factors for Sarkul Damage Per Second
Agi Mastery Vers Crit Haste
Scale Factors 13.34 12.68 11.77 11.48 10.91
Normalized 1.00 0.95 0.88 0.86 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.80 0.80 0.80 0.80 0.81
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Vers ~= Crit ~= Haste
Pawn string ( Pawn: v1: "Sarkul": Agility=13.34, CritRating=11.48, HasteRating=10.91, MasteryRating=12.68, Versatility=11.77 )

Scale Factors for other metrics

Scale Factors for Sarkul Damage Per Second
Agi Mastery Vers Crit Haste
Scale Factors 13.34 12.68 11.77 11.48 10.91
Normalized 1.00 0.95 0.88 0.86 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.80 0.80 0.80 0.80 0.81
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Vers ~= Crit ~= Haste
Pawn string ( Pawn: v1: "Sarkul": Agility=13.34, CritRating=11.48, HasteRating=10.91, MasteryRating=12.68, Versatility=11.77 )
Scale Factors for Sarkul Priority Target Damage Per Second
Haste Mastery Agi Crit Vers
Scale Factors 8.66 7.81 7.56 7.25 7.07
Normalized 1.15 1.03 1.00 0.96 0.94
Scale Deltas 1138 1138 1138 1138 1138
Error 0.26 0.26 0.26 0.26 0.26
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Agi > Crit ~= Vers
Pawn string ( Pawn: v1: "Sarkul": Agility=7.56, CritRating=7.25, HasteRating=8.66, MasteryRating=7.81, Versatility=7.07 )
Scale Factors for Sarkul Damage Per Second (Effective)
Agi Mastery Vers Crit Haste
Scale Factors 13.34 12.68 11.77 11.48 10.91
Normalized 1.00 0.95 0.88 0.86 0.82
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Mastery > Vers > Crit > Haste
Pawn string ( Pawn: v1: "Sarkul": Agility=13.34, CritRating=11.48, HasteRating=10.91, MasteryRating=12.68, Versatility=11.77 )
Scale Factors for Sarkul Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for Sarkul Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )
Scale Factors for SarkulTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Sarkul": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Sarkul 464899
Aimed Shot 98974 (115874) 21.4% (25.1%) 100.9 3.95sec 460222 287866 Direct 100.8 271631 637994 393513 33.3%  

Stats details: aimed_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 100.90 100.79 0.00 0.00 1.5987 0.0000 39660810.91 58305148.82 31.98 287866.33 287866.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 67.25 66.73% 271630.91 112625 298767 271540.75 240839 285864 18268405 26856285 31.98
crit 33.53 33.27% 637993.91 236513 956055 637583.45 524659 751580 21392406 31448864 31.98
 
 

Action details: aimed_shot

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
Spelldata
  • id:19434
  • name:Aimed Shot
  • school:physical
  • tooltip:
  • description:A powerful aimed shot that deals ${$sw1*$<mult>} Physical damage.{$?s19434=true}[][ Replaces Cobra Shot.]
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.04
 
    Legacy of the Windrunners 16899 3.7% 0.0 0.00sec 0 0 Direct 90.2 51777 122675 75094 32.9%  

Stats details: legacy_of_the_windrunners

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.00 90.20 0.00 0.00 0.0000 0.0000 6773468.16 9957639.79 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 60.54 67.11% 51777.20 22083 58582 51765.67 35779 57738 3134440 4607924 31.98
crit 29.66 32.89% 122675.16 46375 187462 122384.35 66250 164979 3639028 5349716 31.98
 
 

Action details: legacy_of_the_windrunners

Static Values
  • id:19434
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:100.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:190852
  • name:Legacy of the Windrunners
  • school:physical
  • tooltip:
  • description:Aimed Shot has a chance to coalesce {$s1=6} extra Wind Arrows that also shoot your target.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.40
 
auto_shot 12484 2.7% 149.7 2.68sec 33369 12513 Direct 149.7 25241 54717 33369 27.6%  

Stats details: auto_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 149.73 149.73 0.00 0.00 2.6666 0.0000 4996390.28 7345166.99 31.98 12513.34 12513.34
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 108.45 72.43% 25240.78 24988 26547 25241.69 25110 25387 2737239 4024001 31.98
crit 41.29 27.57% 54716.57 49977 79642 54715.03 50092 61027 2259151 3321166 31.98
 
 

Action details: auto_shot

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Barrage 89463 19.2% 19.4 21.17sec 1828208 664910 Periodic 1089.4 25353 53608 32588 25.6% 12.1%

Stats details: barrage

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.42 0.00 309.70 1089.42 2.7496 0.1566 35502228.88 52191639.32 31.98 664910.46 664910.46
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 810.5 74.39% 25353.00 19717 41844 25338.95 24115 27208 20547437 30206678 31.98
crit 279.0 25.61% 53608.23 39435 125532 53669.12 47149 60963 14954792 21984961 31.98
 
 

Action details: barrage

Static Values
  • id:120360
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.hunters_mark.down
Spelldata
  • id:120360
  • name:Barrage
  • school:physical
  • tooltip:
  • description:Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.20
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: barrage_primary

Static Values
  • id:120361
  • school:physical
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:120361
  • name:Barrage
  • school:physical
  • tooltip:
  • description:{$@spelldesc120360=Rapidly fires a spray of shots for {$120360d=3 seconds}, dealing $<damagePri> Physical damage to the target and an average of $<damageSec> Physical damage to each other enemy in front of you. Usable while moving.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Deadly Grace 8196 1.7% 30.6 6.34sec 105340 0 Direct 30.3 79983 190018 106448 24.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.61 30.29 0.00 0.00 0.0000 0.0000 3224658.76 3224658.76 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.01 75.95% 79982.54 79983 79983 79982.54 79983 79983 1840358 1840358 0.00
crit 7.29 24.05% 190018.08 159965 239948 189065.37 0 239948 1384300 1384300 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mark of the Hidden Satyr 3828 0.8% 23.2 17.28sec 66055 0 Direct 23.2 50006 108083 66054 27.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 23.20 23.20 0.00 0.00 0.0000 0.0000 1532196.25 1532196.25 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.79 72.37% 50006.14 50006 50006 50006.14 50006 50006 839402 839402 0.00
crit 6.41 27.63% 108082.61 100012 150018 107911.16 0 150018 692794 692794 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Marked Shot 139996 (151078) 30.0% (32.3%) 36.4 11.02sec 1641786 1354278 Direct 117.5 340974 714324 471731 35.0%  

Stats details: marked_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 36.43 117.50 0.00 0.00 1.2123 0.0000 55427141.74 81483148.57 31.98 1354277.95 1354277.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 76.35 64.98% 340974.04 135557 359598 340981.49 330369 345103 26032799 38270681 31.98
crit 41.15 35.02% 714323.67 271113 1078795 714561.68 651542 816090 29394343 43212468 31.98
 
 

Action details: marked_shot

Static Values
  • id:185901
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
Spelldata
  • id:185901
  • name:Marked Shot
  • school:physical
  • tooltip:
  • description:Rapidly fires shots at all targets with your Hunter's Mark, dealing $212621sw2 Physical damage and making them Vulnerable for {$187131d=30 seconds}. |Tinterface\icons\ability_hunter_mastermarksman.blp:24|t |cFFFFFFFFVulnerable|r {$@spelldesc187131=Damage taken from Marked Shot and Aimed Shot increased by {$s2=50}% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.50
 
    Call of the Hunter 11081 2.4% 14.8 50.82sec 296190 0 Direct 54.5 62344 132335 80343 25.7%  

Stats details: call_of_the_hunter

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.78 54.49 0.00 0.00 0.0000 0.0000 4377772.37 6435740.06 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 40.47 74.28% 62344.06 61702 67158 62375.64 61702 67158 2523357 3709573 31.98
crit 14.01 25.72% 132334.78 123404 201475 132557.49 0 193291 1854416 2726167 31.97
 
 

Action details: call_of_the_hunter

Static Values
  • id:191070
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191070
  • name:Call of the Hunter
  • school:physical
  • tooltip:
  • description:{$@spelldesc191048=When you Marked Shot, |cFFFFCC99Thas'dorah|r has a chance to call forth a barrage of wind arrows to strike all Vulnerable targets.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Pepper Breath 3850 0.8% 18.5 21.47sec 83229 0 Periodic 90.8 16976 0 16976 0.0% 5.7%

Stats details: pepper_breath

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.52 0.00 92.06 90.79 0.0000 0.2498 1541275.88 1541275.88 0.00 67020.74 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 90.8 100.00% 16976.25 68 16990 16976.95 16577 16990 1541276 1541276 0.00
 
 

Action details: pepper_breath

Static Values
  • id:225622
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225622
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Fires {$s1=4 to 6} fiery bolts, each dealing {$225624s1=16990} Fire damage.
 

Action details: pepper_breath_damage

Static Values
  • id:225624
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:17.5000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:225624
  • name:Pepper Breath
  • school:fire
  • tooltip:
  • description:Deal {$s1=16990} Fire damage.
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:16990.00
  • base_dd_max:16990.00
 
Rancid Maw 11669 2.5% 18.6 21.39sec 251039 0 Direct 18.4 191428 415259 253289 27.6%  

Stats details: rancid_maw

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 18.59 18.43 0.00 0.00 0.0000 0.0000 4667374.33 4667374.33 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 13.33 72.36% 191427.54 191428 191428 191427.54 191428 191428 2552367 2552367 0.00
crit 5.09 27.64% 415258.82 382855 574283 413289.92 0 574283 2115007 2115007 0.00
 
 

Action details: rancid_maw

Static Values
  • id:215405
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:24.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215405
  • name:Rancid Maw
  • school:nature
  • tooltip:
  • description:{$@spelldesc215404=Your ranged attacks and spells have a chance to launch a ball of venom that deals up to {$215405s1=112984 to 124877} Nature damage, based on your distance from the target (maximum damage at 20 yards).}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:180015.50
  • base_dd_max:198964.50
 
Sidewinders 47197 10.1% 41.7 9.63sec 447722 366808 Direct 142.4 103616 216538 131273 24.5%  

Stats details: sidewinders

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.74 142.35 0.00 0.00 1.2206 0.0000 18687028.59 18687028.59 0.00 366807.90 366807.90
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 107.49 75.51% 103616.08 102499 111563 103616.87 102594 104817 11137359 11137359 0.00
crit 34.87 24.49% 216538.42 204997 334688 216574.10 204997 251191 7549669 7549669 0.00
 
 

Action details: sidewinders

Static Values
  • id:214579
  • school:nature
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
Spelldata
  • id:214579
  • name:Sidewinders
  • school:nature
  • tooltip:
  • description:Launches Sidewinders that travel toward the target, weaving back and forth and dealing {$214581s1=0} Nature damage to each target they hit. Cannot hit the same target twice. Applies Vulnerable to all targets hit. |cFFFFFFFFGenerates {$s2=50} Focus.|r{$?s214579=false}[][ |cFFFFD200Also replaces Multi-Shot.|r]
 
Windburst 21262 4.6% 15.7 24.73sec 542814 397082 Direct 16.6 396327 825840 511191 26.7%  

Stats details: windburst

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.68 16.65 0.00 0.00 1.3670 0.0000 8510660.88 12511477.65 31.98 397082.11 397082.11
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.20 73.26% 396326.61 394346 418442 396312.43 394346 401575 4833533 7105752 31.98
crit 4.45 26.74% 825840.25 788692 1255325 820561.16 0 1255325 3677128 5405726 31.77
 
 

Action details: windburst

Static Values
  • id:204147
  • school:physical
  • resource:focus
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:204147
  • name:Windburst
  • school:physical
  • tooltip:
  • description:Focuses the power of Wind through |cFFFFCC99Thas'dorah|r, dealing $sw1 Physical damage to your target, and leaving behind a trail of wind for {$204475d=5 seconds} that increases the movement speed of allies by {$204477s1=50}%.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:8.00
 
Simple Action Stats Execute Interval
Sarkul
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
Blood Fury 3.8 120.55sec

Stats details: blood_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blood_fury

Static Values
  • id:20572
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:20572
  • name:Blood Fury
  • school:physical
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Sarkul
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Trueshot 2.8 196.66sec

Stats details: trueshot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.76 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: trueshot

Static Values
  • id:193526
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:160.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
Spelldata
  • id:193526
  • name:Trueshot
  • school:physical
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Fury 3.8 0.0 120.5sec 120.5sec 13.89% 13.89% 0.0(0.0) 3.6

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_blood_fury
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:attack_power
  • amount:2243.00

Stack Uptimes

  • blood_fury_1:13.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:20572
  • name:Blood Fury
  • tooltip:Attack power increased by {$s1=2243}.
  • description:Increases attack power by {$s1=2243}. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 21.83% 0.0(0.0) 1.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Bullseye 7.1 303.9 44.2sec 1.1sec 30.38% 30.38% 185.7(185.7) 6.1

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_bullseye
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.01

Stack Uptimes

  • bullseye_1:0.17%
  • bullseye_2:0.18%
  • bullseye_3:0.16%
  • bullseye_4:0.15%
  • bullseye_5:4.02%
  • bullseye_6:0.13%
  • bullseye_7:0.13%
  • bullseye_8:0.13%
  • bullseye_9:0.12%
  • bullseye_10:2.24%
  • bullseye_11:0.12%
  • bullseye_12:0.11%
  • bullseye_13:0.11%
  • bullseye_14:0.10%
  • bullseye_15:0.72%
  • bullseye_16:0.09%
  • bullseye_17:0.09%
  • bullseye_18:0.09%
  • bullseye_19:0.09%
  • bullseye_20:0.81%
  • bullseye_21:0.10%
  • bullseye_22:0.10%
  • bullseye_23:0.10%
  • bullseye_24:0.11%
  • bullseye_25:0.41%
  • bullseye_26:0.11%
  • bullseye_27:0.11%
  • bullseye_28:0.11%
  • bullseye_29:0.11%
  • bullseye_30:19.36%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204090
  • name:Bullseye
  • tooltip:Critical strike chance increased by {$s1=1}%.
  • description:{$@spelldesc204089=When your abilities damage a target below {$s1=20}% health, you gain {$204090s1=1}% increased critical strike chance for {$204090d=6 seconds}, stacking up to {$204090u=30} times.}
  • max_stacks:30
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Lock and Load 11.3 0.6 33.5sec 31.6sec 9.26% 11.14% 0.6(0.8) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_lock_and_load
  • max_stacks:2
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lock_and_load_1:4.84%
  • lock_and_load_2:4.42%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194594
  • name:Lock and Load
  • tooltip:Aimed Shot costs no Focus and is instant.
  • description:$@spelldesc198811
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Marking Targets 35.0 10.5 11.5sec 8.8sec 36.53% 49.99% 10.5(10.5) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_marking_targets
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marking_targets_1:36.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:223138
  • name:Marking Targets
  • tooltip:Next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark.
  • description:Your next {$?s214579=false}[Sidewinders][Arcane Shot or Multi-Shot] will apply Hunter's Mark. Hunter's Mark activates Marked Shot.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of Deadly Grace 2.0 0.0 154.2sec 0.0sec 14.69% 14.69% 0.0(0.0) 2.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:14.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rapid Killing 2.8 0.0 187.7sec 196.7sec 10.22% 10.62% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_rapid_killing
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • rapid_killing_1:10.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:191342
  • name:Rapid Killing
  • tooltip:Critical damage increased by {$s1=50}%.
  • description:{$@spelldesc191339=Trueshot also increases your critical strike damage by {$191342s1=50}% for its duration.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Trueshot 2.8 0.0 187.7sec 196.7sec 10.22% 16.23% 0.0(0.0) 2.7

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_trueshot
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.40

Stack Uptimes

  • trueshot_1:10.22%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193526
  • name:Trueshot
  • tooltip:Haste increased by {$s1=40}% and Arcane Shot and Multi-Shot apply Hunter's Mark.
  • description:Increases haste by {$s1=40}% and causes Arcane Shot and Multi-Shot to always apply Hunter's Mark. Lasts {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Sarkul
aimed_shot Focus 100.9 3901.3 38.7 38.7 11902.1
barrage Focus 19.4 1165.2 60.0 60.0 30469.9
marked_shot Focus 36.4 1092.8 30.0 30.0 54724.7
windburst Focus 16.7 333.6 20.0 21.3 25513.4
Resource Gains Type Count Total Average Overflow
sidewinders Focus 41.74 1946.48 (30.30%) 46.64 140.43 6.73%
focus_regen Focus 1422.86 4478.20 (69.70%) 3.15 421.96 8.61%
Resource RPS-Gain RPS-Loss
Focus 16.04 16.21
Combat End Resource Mean Min Max
Focus 81.60 2.48 150.00

Benefits & Uptimes

Benefits %
Uptimes %
Focus Cap 7.2%

Procs

Count Interval
starved: barrage 107.6 5.1sec
lock_and_load 11.9 31.6sec
no_vuln_aimed_shot 6.3 42.3sec
no_vuln_marked_shot 5.2 57.2sec
marking_targets 45.5 8.8sec
wasted_marking_targets 10.5 34.9sec

Statistics & Data Analysis

Fight Length
Sample Data Sarkul Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Sarkul Damage Per Second
Count 9999
Mean 464899.38
Minimum 380418.62
Maximum 585581.81
Spread ( max - min ) 205163.19
Range [ ( max - min ) / 2 * 100% ] 22.07%
Standard Deviation 32686.6676
5th Percentile 416524.22
95th Percentile 522883.10
( 95th Percentile - 5th Percentile ) 106358.88
Mean Distribution
Standard Deviation 326.8830
95.00% Confidence Intervall ( 464258.70 - 465540.06 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 189
0.1% Error 18989
0.1 Scale Factor Error with Delta=300 9120632
0.05 Scale Factor Error with Delta=300 36482530
0.01 Scale Factor Error with Delta=300 912063260
Priority Target DPS
Sample Data Sarkul Priority Target Damage Per Second
Count 9999
Mean 278181.85
Minimum 243343.93
Maximum 322464.13
Spread ( max - min ) 79120.20
Range [ ( max - min ) / 2 * 100% ] 14.22%
Standard Deviation 10455.7658
5th Percentile 261400.19
95th Percentile 295843.24
( 95th Percentile - 5th Percentile ) 34443.05
Mean Distribution
Standard Deviation 104.5629
95.00% Confidence Intervall ( 277976.91 - 278386.78 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 54
0.1% Error 5426
0.1 Scale Factor Error with Delta=300 933244
0.05 Scale Factor Error with Delta=300 3732977
0.01 Scale Factor Error with Delta=300 93324432
DPS(e)
Sample Data Sarkul Damage Per Second (Effective)
Count 9999
Mean 464899.38
Minimum 380418.62
Maximum 585581.81
Spread ( max - min ) 205163.19
Range [ ( max - min ) / 2 * 100% ] 22.07%
Damage
Sample Data Sarkul Damage
Count 9999
Mean 184901007.06
Minimum 143075481.38
Maximum 224307762.33
Spread ( max - min ) 81232280.95
Range [ ( max - min ) / 2 * 100% ] 21.97%
DTPS
Sample Data Sarkul Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Sarkul Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Sarkul Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Sarkul Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Sarkul Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Sarkul Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data SarkulTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Sarkul Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_seventh_demon
1 0.00 food,type=fishbrul_special
2 0.00 summon_pet
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 augmentation,type=defiled
6 0.00 windburst
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 auto_shot
0.00 arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
8 3.76 blood_fury
0.00 berserking
0.00 auto_shot
0.00 variable,name=vulnerable_time,value=debuff.vulnerability.remains
9 0.00 call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
A 0.00 call_action_list,name=cooldowns
0.00 a_murder_of_crows,if=debuff.hunters_mark.down
B 0.00 call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
C 11.95 barrage,if=debuff.hunters_mark.down
0.00 black_arrow,if=debuff.hunters_mark.down
0.00 a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
D 6.47 barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
0.00 black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
0.00 piercing_shot,if=!talent.patient_sniper.enabled&focus>50
E 17.66 windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
0.00 windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
F 0.00 call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
G 11.67 sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
0.00 sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
0.00 marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
0.00 arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
0.00 arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
0.00 explosive_shot
H 21.14 marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
I 29.47 aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
J 67.80 aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
K 10.59 marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
L 0.94 marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
M 26.19 sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
0.00 piercing_shot,if=talent.patient_sniper.enabled&focus>80
0.00 arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
0.00 multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
N 7.44 aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
0.00 multishot,if=spell_targets.barrage>2
actions.cooldowns
# count action,conditions
O 1.00 potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
P 1.76 /trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16
actions.open
# count action,conditions
0.00 a_murder_of_crows
Q 1.00 trueshot
R 1.22 sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
S 2.99 marked_shot
T 1.15 aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
0.00 black_arrow
U 1.00 barrage
V 7.76 aimed_shot,if=execute_time<debuff.vulnerability.remains
W 1.86 sidewinders
0.00 aimed_shot
0.00 arcane_shot
actions.targetdie
# count action,conditions
X 0.77 marked_shot
0.00 windburst
Y 1.37 aimed_shot,if=execute_time<debuff.vulnerability.remains
Z 0.81 sidewinders
a 0.05 aimed_shot
0.00 arcane_shot

Sample Sequence

045678QUVVRSVVWSVVWSVVMIIIHCEJJMHJJJMHJJJCGEJJMHJJMHCJEJJJMIIKCMHJEJJJGJJCMIIHEJJJG8HJCMHJJJEJJGHJCMHJJJEJPJGIIDKGIHJJMHJEJJJGDOHJJGJJMHECMHJJNMHJJEJMDHJMH8JJEJMDIKMIHJENCMHJJMIIKJEJCJMHJJNECGILJJMIIKJMIDPEIKGIIKJGIIKJMDEI8IKJJMIIKJMDKEMIIXYZXY

Sample Sequence Table

time name target resources buffs
Pre flask Sarkul 150.0/150: 100% focus
Pre potion Fluffy_Pillow 150.0/150: 100% focus potion_of_deadly_grace
Pre augmentation Sarkul 150.0/150: 100% focus potion_of_deadly_grace
0:00.000 windburst Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 start_auto_shot Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 blood_fury Fluffy_Pillow 130.0/150: 87% focus potion_of_deadly_grace
0:00.000 trueshot Fluffy_Pillow 130.0/150: 87% focus blood_fury, potion_of_deadly_grace
0:00.000 barrage Fluffy_Pillow 130.0/150: 87% focus blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:02.143 aimed_shot Fluffy_Pillow 110.3/150: 74% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:03.110 aimed_shot Fluffy_Pillow 80.3/150: 54% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.079 sidewinders Fluffy_Pillow 50.4/150: 34% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:04.833 marked_shot Fluffy_Pillow 116.0/150: 77% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:05.588 aimed_shot Fluffy_Pillow 101.7/150: 68% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:06.556 aimed_shot Fluffy_Pillow 71.8/150: 48% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:07.523 sidewinders Fluffy_Pillow 41.8/150: 28% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:08.277 marked_shot Fluffy_Pillow 107.5/150: 72% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:09.031 aimed_shot Fluffy_Pillow 93.1/150: 62% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.000 aimed_shot Fluffy_Pillow 63.2/150: 42% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:10.969 sidewinders Fluffy_Pillow 33.3/150: 22% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:11.724 marked_shot Fluffy_Pillow 98.9/150: 66% focus bloodlust, blood_fury, rapid_killing, trueshot, potion_of_deadly_grace
0:12.478 Waiting 0.700 sec 84.6/150: 56% focus bloodlust, blood_fury, raid_movement, rapid_killing, trueshot, potion_of_deadly_grace
0:13.178 aimed_shot Fluffy_Pillow 99.1/150: 66% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:14.146 aimed_shot Fluffy_Pillow 69.2/150: 46% focus bloodlust, blood_fury, marking_targets, rapid_killing, trueshot, potion_of_deadly_grace
0:15.115 Waiting 0.300 sec 38.6/150: 26% focus bloodlust, marking_targets, potion_of_deadly_grace
0:15.415 sidewinders Fluffy_Pillow 43.0/150: 29% focus bloodlust, marking_targets, potion_of_deadly_grace
0:16.668 aimed_shot Fluffy_Pillow 111.6/150: 74% focus bloodlust, potion_of_deadly_grace
0:18.020 aimed_shot Fluffy_Pillow 131.6/150: 88% focus bloodlust, lock_and_load, potion_of_deadly_grace
0:19.038 aimed_shot Fluffy_Pillow 146.7/150: 98% focus bloodlust, potion_of_deadly_grace
0:20.056 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:21.072 barrage Fluffy_Pillow 135.0/150: 90% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:23.334 Waiting 0.300 sec 108.6/150: 72% focus bloodlust, raid_movement, marking_targets, potion_of_deadly_grace
0:23.634 windburst Fluffy_Pillow 113.0/150: 75% focus bloodlust, marking_targets, potion_of_deadly_grace
0:24.651 aimed_shot Fluffy_Pillow 108.1/150: 72% focus bloodlust, marking_targets, potion_of_deadly_grace
0:26.004 aimed_shot Fluffy_Pillow 78.1/150: 52% focus bloodlust, marking_targets, potion_of_deadly_grace
0:27.359 sidewinders Fluffy_Pillow 48.2/150: 32% focus bloodlust, marking_targets, potion_of_deadly_grace
0:28.375 marked_shot Fluffy_Pillow 113.2/150: 75% focus bloodlust, raid_movement, marking_targets
0:29.390 aimed_shot Fluffy_Pillow 98.3/150: 66% focus bloodlust, marking_targets
0:30.745 aimed_shot Fluffy_Pillow 68.3/150: 46% focus bloodlust, marking_targets
0:32.099 aimed_shot Fluffy_Pillow 88.4/150: 59% focus bloodlust, lock_and_load, marking_targets
0:33.115 sidewinders Fluffy_Pillow 103.4/150: 69% focus bloodlust, marking_targets
0:34.133 marked_shot Fluffy_Pillow 150.0/150: 100% focus bloodlust
0:35.149 aimed_shot Fluffy_Pillow 135.0/150: 90% focus bloodlust
0:36.504 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bloodlust
0:37.858 aimed_shot Fluffy_Pillow 70.1/150: 47% focus bloodlust
0:39.211 Waiting 1.700 sec 40.2/150: 27% focus bloodlust
0:40.911 barrage Fluffy_Pillow 65.4/150: 44% focus bloodlust
0:43.941 Waiting 1.000 sec 39.9/150: 27% focus
0:44.941 sidewinders Fluffy_Pillow 51.3/150: 34% focus raid_movement
0:46.262 windburst Fluffy_Pillow 116.3/150: 78% focus
0:47.581 aimed_shot Fluffy_Pillow 111.4/150: 74% focus
0:49.340 aimed_shot Fluffy_Pillow 81.4/150: 54% focus
0:50.661 Waiting 1.500 sec 96.4/150: 64% focus raid_movement
0:52.161 sidewinders Fluffy_Pillow 113.5/150: 76% focus raid_movement, marking_targets
0:53.481 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement
0:54.801 aimed_shot Fluffy_Pillow 135.0/150: 90% focus
0:56.560 aimed_shot Fluffy_Pillow 100.0/150: 67% focus
0:58.318 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
0:59.639 marked_shot Fluffy_Pillow 135.1/150: 90% focus
1:00.960 barrage Fluffy_Pillow 120.2/150: 80% focus raid_movement, lock_and_load(2)
1:04.037 aimed_shot Fluffy_Pillow 95.2/150: 63% focus lock_and_load(2)
1:05.357 Waiting 2.000 sec 110.3/150: 74% focus lock_and_load
1:07.357 windburst Fluffy_Pillow 133.1/150: 89% focus lock_and_load
1:08.898 aimed_shot Fluffy_Pillow 130.0/150: 87% focus lock_and_load
1:10.219 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
1:11.978 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets
1:13.738 sidewinders Fluffy_Pillow 70.1/150: 47% focus marking_targets
1:15.060 aimed_shot Fluffy_Pillow 135.2/150: 90% focus
1:16.379 Waiting 0.800 sec 150.0/150: 100% focus raid_movement
1:17.179 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
1:18.938 marked_shot Fluffy_Pillow 100.0/150: 67% focus
1:20.259 Waiting 0.600 sec 85.1/150: 57% focus raid_movement
1:20.859 barrage Fluffy_Pillow 91.9/150: 61% focus raid_movement
1:23.989 Waiting 0.300 sec 67.6/150: 45% focus
1:24.289 sidewinders Fluffy_Pillow 71.0/150: 47% focus marking_targets
1:25.610 marked_shot Fluffy_Pillow 136.1/150: 91% focus
1:26.931 aimed_shot Fluffy_Pillow 121.1/150: 81% focus
1:28.692 windburst Fluffy_Pillow 91.2/150: 61% focus
1:30.215 aimed_shot Fluffy_Pillow 88.5/150: 59% focus
1:31.974 aimed_shot Fluffy_Pillow 58.6/150: 39% focus
1:33.293 aimed_shot Fluffy_Pillow 73.6/150: 49% focus
1:35.053 Waiting 2.300 sec 43.7/150: 29% focus
1:37.353 sidewinders Fluffy_Pillow 69.9/150: 47% focus
1:38.673 aimed_shot Fluffy_Pillow 134.9/150: 90% focus bullseye(5)
1:40.433 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(5)
1:42.192 barrage Fluffy_Pillow 70.1/150: 47% focus bullseye(5)
1:44.994 Waiting 0.400 sec 42.0/150: 28% focus
1:45.394 sidewinders Fluffy_Pillow 46.6/150: 31% focus marking_targets
1:46.713 aimed_shot Fluffy_Pillow 111.6/150: 74% focus
1:48.033 Waiting 1.200 sec 126.7/150: 84% focus raid_movement, lock_and_load(2)
1:49.233 aimed_shot Fluffy_Pillow 140.3/150: 94% focus lock_and_load(2)
1:50.554 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load
1:51.876 Waiting 1.700 sec 135.1/150: 90% focus raid_movement, lock_and_load, marking_targets
1:53.576 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
1:54.897 aimed_shot Fluffy_Pillow 130.1/150: 87% focus lock_and_load, marking_targets
1:56.218 aimed_shot Fluffy_Pillow 145.1/150: 97% focus lock_and_load(2), marking_targets
1:57.538 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
1:58.858 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
2:00.178 blood_fury Fluffy_Pillow 150.0/150: 100% focus
2:00.178 marked_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury
2:01.500 aimed_shot Fluffy_Pillow 135.1/150: 90% focus blood_fury
2:03.259 barrage Fluffy_Pillow 100.0/150: 67% focus blood_fury
2:06.151 Waiting 0.300 sec 73.0/150: 49% focus blood_fury
2:06.451 sidewinders Fluffy_Pillow 76.4/150: 51% focus blood_fury, lock_and_load(2), marking_targets
2:07.771 marked_shot Fluffy_Pillow 141.5/150: 94% focus blood_fury, bullseye(5), lock_and_load(2)
2:09.090 aimed_shot Fluffy_Pillow 126.5/150: 84% focus blood_fury, bullseye(10), lock_and_load(2), marking_targets
2:10.410 aimed_shot Fluffy_Pillow 141.5/150: 94% focus blood_fury, bullseye(10), lock_and_load, marking_targets
2:11.731 aimed_shot Fluffy_Pillow 150.0/150: 100% focus blood_fury, bullseye(10), marking_targets
2:13.490 Waiting 1.200 sec 100.0/150: 67% focus blood_fury, bullseye(10), marking_targets
2:14.690 windburst Fluffy_Pillow 113.7/150: 76% focus blood_fury, marking_targets
2:16.212 aimed_shot Fluffy_Pillow 111.1/150: 74% focus marking_targets
2:17.971 aimed_shot Fluffy_Pillow 81.1/150: 54% focus marking_targets
2:19.730 sidewinders Fluffy_Pillow 51.1/150: 34% focus marking_targets
2:21.051 marked_shot Fluffy_Pillow 116.2/150: 77% focus
2:22.372 aimed_shot Fluffy_Pillow 101.2/150: 67% focus
2:24.132 barrage Fluffy_Pillow 71.3/150: 48% focus
2:26.928 Waiting 3.000 sec 43.2/150: 29% focus
2:29.928 sidewinders Fluffy_Pillow 77.3/150: 52% focus lock_and_load(2), marking_targets
2:31.248 marked_shot Fluffy_Pillow 142.4/150: 95% focus lock_and_load(2)
2:32.568 aimed_shot Fluffy_Pillow 127.4/150: 85% focus lock_and_load(2)
2:33.889 aimed_shot Fluffy_Pillow 142.5/150: 95% focus lock_and_load
2:35.210 aimed_shot Fluffy_Pillow 150.0/150: 100% focus
2:36.530 Waiting 0.700 sec 150.0/150: 100% focus raid_movement
2:37.230 windburst Fluffy_Pillow 150.0/150: 100% focus
2:38.549 aimed_shot Fluffy_Pillow 130.0/150: 87% focus
2:40.307 trueshot Fluffy_Pillow 100.0/150: 67% focus
2:40.307 aimed_shot Fluffy_Pillow 100.0/150: 67% focus rapid_killing, trueshot
2:41.564 sidewinders Fluffy_Pillow 70.1/150: 47% focus rapid_killing, trueshot
2:42.510 aimed_shot Fluffy_Pillow 135.2/150: 90% focus rapid_killing, trueshot
2:43.767 aimed_shot Fluffy_Pillow 100.1/150: 67% focus rapid_killing, trueshot
2:45.024 barrage Fluffy_Pillow 70.1/150: 47% focus marking_targets, rapid_killing, trueshot
2:47.234 marked_shot Fluffy_Pillow 45.4/150: 30% focus marking_targets, rapid_killing, trueshot
2:48.179 sidewinders Fluffy_Pillow 30.4/150: 20% focus lock_and_load(2), marking_targets, rapid_killing, trueshot
2:49.123 aimed_shot Fluffy_Pillow 95.5/150: 64% focus lock_and_load(2), rapid_killing, trueshot
2:50.069 marked_shot Fluffy_Pillow 110.6/150: 74% focus raid_movement, lock_and_load, marking_targets, rapid_killing, trueshot
2:51.014 Waiting 1.600 sec 95.7/150: 64% focus raid_movement, lock_and_load, marking_targets, rapid_killing, trueshot
2:52.614 aimed_shot Fluffy_Pillow 121.2/150: 81% focus lock_and_load, marking_targets, rapid_killing, trueshot
2:53.559 aimed_shot Fluffy_Pillow 136.3/150: 91% focus marking_targets, rapid_killing, trueshot
2:54.818 sidewinders Fluffy_Pillow 100.1/150: 67% focus marking_targets, rapid_killing, trueshot
2:55.763 marked_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load(2)
2:57.084 aimed_shot Fluffy_Pillow 135.1/150: 90% focus lock_and_load(2), marking_targets
2:58.404 windburst Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
2:59.867 aimed_shot Fluffy_Pillow 130.1/150: 87% focus lock_and_load, marking_targets
3:01.189 aimed_shot Fluffy_Pillow 145.1/150: 97% focus marking_targets
3:02.948 aimed_shot Fluffy_Pillow 150.0/150: 100% focus lock_and_load, marking_targets
3:04.269 sidewinders Fluffy_Pillow 150.0/150: 100% focus marking_targets
3:05.588 barrage Fluffy_Pillow 150.0/150: 100% focus
3:08.391 potion Fluffy_Pillow 121.9/150: 81% focus raid_movement, bullseye(30)
3:08.391 marked_shot Fluffy_Pillow 121.9/150: 81% focus raid_movement, bullseye(30), potion_of_deadly_grace
3:09.712 aimed_shot Fluffy_Pillow 107.0/150: 71% focus bullseye(30), potion_of_deadly_grace
3:11.473 aimed_shot Fluffy_Pillow 77.1/150: 51% focus bullseye(30), potion_of_deadly_grace
3:13.233 Waiting 0.600 sec 47.1/150: 31% focus bullseye(30), potion_of_deadly_grace
3:13.833 sidewinders Fluffy_Pillow 53.9/150: 36% focus bullseye(30), potion_of_deadly_grace
3:15.153 aimed_shot Fluffy_Pillow 119.0/150: 79% focus potion_of_deadly_grace
3:16.913 aimed_shot Fluffy_Pillow 89.0/150: 59% focus potion_of_deadly_grace
3:18.671 Waiting 0.600 sec 59.1/150: 39% focus potion_of_deadly_grace
3:19.271 sidewinders Fluffy_Pillow 65.9/150: 44% focus marking_targets, potion_of_deadly_grace
3:20.591 marked_shot Fluffy_Pillow 130.9/150: 87% focus raid_movement, potion_of_deadly_grace
3:21.913 Waiting 1.700 sec 116.0/150: 77% focus raid_movement, marking_targets, potion_of_deadly_grace
3:23.613 windburst Fluffy_Pillow 135.4/150: 90% focus marking_targets, potion_of_deadly_grace
3:24.933 Waiting 0.500 sec 150.0/150: 100% focus raid_movement, marking_targets, potion_of_deadly_grace
3:25.433 barrage Fluffy_Pillow 150.0/150: 100% focus marking_targets, potion_of_deadly_grace
3:28.467 sidewinders Fluffy_Pillow 122.8/150: 82% focus marking_targets, potion_of_deadly_grace
3:29.788 marked_shot Fluffy_Pillow 150.0/150: 100% focus marking_targets, potion_of_deadly_grace
3:31.110 aimed_shot Fluffy_Pillow 135.1/150: 90% focus marking_targets, potion_of_deadly_grace
3:32.869 aimed_shot Fluffy_Pillow 100.0/150: 67% focus marking_targets, potion_of_deadly_grace
3:34.629 Waiting 1.200 sec 70.1/150: 47% focus marking_targets, potion_of_deadly_grace
3:35.829 aimed_shot Fluffy_Pillow 83.8/150: 56% focus marking_targets, potion_of_deadly_grace
3:37.589 sidewinders Fluffy_Pillow 53.8/150: 36% focus marking_targets, potion_of_deadly_grace
3:38.910 marked_shot Fluffy_Pillow 118.9/150: 79% focus bullseye(5)
3:40.230 Waiting 1.000 sec 103.9/150: 69% focus raid_movement, bullseye(10)
3:41.230 aimed_shot Fluffy_Pillow 115.3/150: 77% focus bullseye(10)
3:42.989 aimed_shot Fluffy_Pillow 85.4/150: 57% focus bullseye(10), marking_targets
3:44.748 windburst Fluffy_Pillow 55.4/150: 37% focus bullseye(10), marking_targets
3:46.068 aimed_shot Fluffy_Pillow 50.4/150: 34% focus marking_targets
3:47.828 sidewinders Fluffy_Pillow 20.5/150: 14% focus marking_targets
3:49.148 barrage Fluffy_Pillow 85.5/150: 57% focus
3:51.881 marked_shot Fluffy_Pillow 56.7/150: 38% focus raid_movement
3:53.201 Waiting 0.800 sec 41.7/150: 28% focus raid_movement
3:54.001 aimed_shot Fluffy_Pillow 50.8/150: 34% focus
3:55.760 Waiting 1.800 sec 20.9/150: 14% focus
3:57.560 sidewinders Fluffy_Pillow 41.4/150: 28% focus marking_targets
3:58.881 marked_shot Fluffy_Pillow 106.4/150: 71% focus
4:00.203 blood_fury Fluffy_Pillow 91.5/150: 61% focus
4:00.203 aimed_shot Fluffy_Pillow 91.5/150: 61% focus blood_fury
4:01.962 aimed_shot Fluffy_Pillow 61.5/150: 41% focus blood_fury
4:03.721 Waiting 2.100 sec 31.6/150: 21% focus blood_fury
4:05.821 windburst Fluffy_Pillow 55.5/150: 37% focus blood_fury
4:07.383 aimed_shot Fluffy_Pillow 53.3/150: 36% focus blood_fury
4:09.143 sidewinders Fluffy_Pillow 23.4/150: 16% focus blood_fury, marking_targets
4:10.464 barrage Fluffy_Pillow 88.4/150: 59% focus blood_fury, bullseye(5)
4:13.331 aimed_shot Fluffy_Pillow 61.1/150: 41% focus blood_fury, bullseye(5)
4:15.090 marked_shot Fluffy_Pillow 31.1/150: 21% focus blood_fury, bullseye(5)
4:16.412 Waiting 1.400 sec 16.2/150: 11% focus marking_targets
4:17.812 sidewinders Fluffy_Pillow 32.1/150: 21% focus marking_targets
4:19.309 aimed_shot Fluffy_Pillow 99.2/150: 66% focus
4:20.632 marked_shot Fluffy_Pillow 114.3/150: 76% focus raid_movement
4:21.950 Waiting 1.700 sec 99.3/150: 66% focus raid_movement, marking_targets
4:23.650 aimed_shot Fluffy_Pillow 118.7/150: 79% focus marking_targets
4:25.410 Waiting 1.800 sec 88.7/150: 59% focus marking_targets
4:27.210 windburst Fluffy_Pillow 109.2/150: 73% focus marking_targets
4:28.700 Waiting 0.500 sec 126.2/150: 84% focus raid_movement, marking_targets
4:29.200 aimed_shot Fluffy_Pillow 131.9/150: 88% focus marking_targets
4:30.958 barrage Fluffy_Pillow 100.0/150: 67% focus marking_targets
4:33.915 sidewinders Fluffy_Pillow 73.7/150: 49% focus marking_targets
4:35.234 marked_shot Fluffy_Pillow 138.8/150: 93% focus
4:36.554 aimed_shot Fluffy_Pillow 123.8/150: 83% focus
4:38.312 aimed_shot Fluffy_Pillow 93.8/150: 63% focus marking_targets
4:40.071 sidewinders Fluffy_Pillow 63.9/150: 43% focus marking_targets
4:41.390 aimed_shot Fluffy_Pillow 128.9/150: 86% focus
4:43.150 aimed_shot Fluffy_Pillow 99.0/150: 66% focus
4:44.470 Waiting 0.700 sec 114.0/150: 76% focus raid_movement
4:45.170 marked_shot Fluffy_Pillow 122.0/150: 81% focus marking_targets
4:46.491 aimed_shot Fluffy_Pillow 107.0/150: 71% focus marking_targets
4:48.250 windburst Fluffy_Pillow 77.1/150: 51% focus marking_targets
4:49.570 aimed_shot Fluffy_Pillow 72.1/150: 48% focus marking_targets
4:50.892 barrage Fluffy_Pillow 87.2/150: 58% focus raid_movement, marking_targets
4:53.728 aimed_shot Fluffy_Pillow 59.5/150: 40% focus marking_targets
4:55.490 sidewinders Fluffy_Pillow 29.6/150: 20% focus marking_targets
4:56.811 marked_shot Fluffy_Pillow 94.6/150: 63% focus
4:58.130 aimed_shot Fluffy_Pillow 79.6/150: 53% focus
4:59.889 Waiting 0.100 sec 49.7/150: 33% focus
4:59.989 aimed_shot Fluffy_Pillow 50.8/150: 34% focus
5:01.309 Waiting 1.600 sec 65.9/150: 44% focus
5:02.909 aimed_shot Fluffy_Pillow 84.1/150: 56% focus
5:04.669 Waiting 4.700 sec 54.1/150: 36% focus
5:09.369 windburst Fluffy_Pillow 107.7/150: 72% focus lock_and_load(2)
5:10.887 barrage Fluffy_Pillow 105.0/150: 70% focus lock_and_load(2), marking_targets
5:13.808 sidewinders Fluffy_Pillow 78.3/150: 52% focus lock_and_load(2), marking_targets
5:15.127 aimed_shot Fluffy_Pillow 143.3/150: 96% focus lock_and_load(2), marking_targets
5:16.448 marked_shot Fluffy_Pillow 150.0/150: 100% focus raid_movement, lock_and_load, marking_targets
5:17.771 aimed_shot Fluffy_Pillow 135.1/150: 90% focus bullseye, lock_and_load, marking_targets
5:19.091 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(2), marking_targets
5:20.850 sidewinders Fluffy_Pillow 100.0/150: 67% focus bullseye(3), marking_targets
5:22.172 aimed_shot Fluffy_Pillow 150.0/150: 100% focus bullseye(6), marking_targets
5:23.932 aimed_shot Fluffy_Pillow 100.1/150: 67% focus bullseye(6), marking_targets
5:25.692 Waiting 0.200 sec 70.1/150: 47% focus bullseye(8), marking_targets
5:25.892 marked_shot Fluffy_Pillow 72.4/150: 48% focus bullseye(8), marking_targets
5:27.213 aimed_shot Fluffy_Pillow 57.4/150: 38% focus bullseye(16), marking_targets
5:28.971 sidewinders Fluffy_Pillow 27.5/150: 18% focus bullseye(17), marking_targets
5:30.293 aimed_shot Fluffy_Pillow 92.5/150: 62% focus bullseye(20), marking_targets
5:32.005 barrage Fluffy_Pillow 112.0/150: 75% focus raid_movement, bullseye(20), marking_targets
5:34.837 trueshot Fluffy_Pillow 84.3/150: 56% focus bullseye(30), marking_targets
5:34.837 windburst Fluffy_Pillow 84.3/150: 56% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:35.780 aimed_shot Fluffy_Pillow 79.4/150: 53% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:37.036 marked_shot Fluffy_Pillow 49.4/150: 33% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:37.981 sidewinders Fluffy_Pillow 34.5/150: 23% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:38.926 aimed_shot Fluffy_Pillow 99.5/150: 66% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:40.184 aimed_shot Fluffy_Pillow 69.6/150: 46% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:41.441 marked_shot Fluffy_Pillow 39.7/150: 26% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:42.386 Waiting 1.600 sec 24.7/150: 16% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:43.986 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:45.244 sidewinders Fluffy_Pillow 20.3/150: 14% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:46.345 aimed_shot Fluffy_Pillow 87.9/150: 59% focus bullseye(30), rapid_killing, trueshot
5:47.603 aimed_shot Fluffy_Pillow 58.0/150: 39% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:48.550 marked_shot Fluffy_Pillow 73.1/150: 49% focus raid_movement, bullseye(30), marking_targets, rapid_killing, trueshot
5:49.496 aimed_shot Fluffy_Pillow 58.1/150: 39% focus bullseye(30), marking_targets, rapid_killing, trueshot
5:50.754 Waiting 2.000 sec 24.0/150: 16% focus bullseye(30), marking_targets
5:52.754 sidewinders Fluffy_Pillow 46.8/150: 31% focus bullseye(30), marking_targets
5:54.245 barrage Fluffy_Pillow 113.8/150: 76% focus bullseye(30)
5:57.141 windburst Fluffy_Pillow 86.8/150: 58% focus bullseye(30)
5:58.462 aimed_shot Fluffy_Pillow 81.9/150: 55% focus bullseye(30)
6:00.220 blood_fury Fluffy_Pillow 51.9/150: 35% focus bullseye(30)
6:00.220 aimed_shot Fluffy_Pillow 51.9/150: 35% focus blood_fury, bullseye(30)
6:01.980 Waiting 1.500 sec 21.9/150: 15% focus blood_fury, bullseye(30)
6:03.480 marked_shot Fluffy_Pillow 39.0/150: 26% focus blood_fury, bullseye(30)
6:04.802 Waiting 0.500 sec 24.1/150: 16% focus blood_fury, raid_movement, bullseye(30)
6:05.302 aimed_shot Fluffy_Pillow 29.8/150: 20% focus blood_fury, bullseye(30), lock_and_load(2)
6:06.622 aimed_shot Fluffy_Pillow 44.8/150: 30% focus blood_fury, bullseye(30), lock_and_load
6:07.945 sidewinders Fluffy_Pillow 59.9/150: 40% focus blood_fury, bullseye(30), marking_targets
6:09.266 aimed_shot Fluffy_Pillow 125.0/150: 83% focus blood_fury, bullseye(30)
6:11.026 aimed_shot Fluffy_Pillow 95.0/150: 63% focus blood_fury, bullseye(30), marking_targets
6:12.786 Waiting 0.200 sec 65.1/150: 43% focus blood_fury, bullseye(30), marking_targets
6:12.986 marked_shot Fluffy_Pillow 67.4/150: 45% focus blood_fury, bullseye(30), marking_targets
6:14.307 aimed_shot Fluffy_Pillow 52.4/150: 35% focus blood_fury, bullseye(30), marking_targets
6:16.065 sidewinders Fluffy_Pillow 22.4/150: 15% focus bullseye(30), marking_targets
6:17.386 barrage Fluffy_Pillow 87.5/150: 58% focus bullseye(30)
6:20.296 Waiting 0.800 sec 60.6/150: 40% focus raid_movement, bullseye(30)
6:21.096 marked_shot Fluffy_Pillow 69.8/150: 47% focus raid_movement, bullseye(30), marking_targets
6:22.416 windburst Fluffy_Pillow 54.8/150: 37% focus bullseye(30), marking_targets
6:23.737 sidewinders Fluffy_Pillow 49.8/150: 33% focus bullseye(30), marking_targets
6:25.057 aimed_shot Fluffy_Pillow 114.9/150: 77% focus bullseye(30)
6:26.816 aimed_shot Fluffy_Pillow 84.9/150: 57% focus bullseye(30), marking_targets
6:28.575 Waiting 0.200 sec 55.0/150: 37% focus bullseye(30), marking_targets
6:28.775 marked_shot Fluffy_Pillow 57.3/150: 38% focus bullseye(30), marking_targets
6:30.096 Waiting 0.700 sec 42.3/150: 28% focus bullseye(30), marking_targets
6:30.796 aimed_shot Fluffy_Pillow 50.3/150: 34% focus bullseye(30), marking_targets
6:32.554 sidewinders Fluffy_Pillow 20.3/150: 14% focus bullseye(30), marking_targets
6:33.872 marked_shot Fluffy_Pillow 85.3/150: 57% focus bullseye(30), marking_targets
6:35.192 aimed_shot Fluffy_Pillow 70.4/150: 47% focus bullseye(30), marking_targets

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6234 6234 0
Agility 25023 23658 13505 (9019)
Stamina 34551 34551 21604
Intellect 6003 6003 0
Spirit 2 2 0
Health 2073060 2073060 0
Focus 150 150 0
Crit 20.73% 20.73% 2005
Haste 13.94% 13.94% 4531
Damage / Heal Versatility 1.02% 1.02% 409
Attack Power 25023 23658 0
Mastery 26.75% 26.75% 12180
Armor 2608 2608 2608
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 860.00
Local Head Greyed Dragonscale Coif
ilevel: 870, stats: { 358 Armor, +2344 Sta, +1563 AgiInt, +794 Mastery, +613 Crit }
Local Neck Wolfstride Pendant
ilevel: 850, stats: { +1094 Sta, +1311 Mastery, +525 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Thorny Bramblemail Pauldrons
ilevel: 850, stats: { 310 Armor, +1459 Sta, +973 AgiInt, +658 Mastery, +322 Haste }, gems: { +150 Mastery }
Local Shirt Wraps of the Blood-Soaked Brawler
ilevel: 1
Local Chest Mountainforged Chain Hauberk
ilevel: 850, stats: { 414 Armor, +1945 Sta, +1297 AgiInt, +654 Haste, +654 Mastery }
Local Waist Roar of the Seven Lions
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 Agi, +662 Haste, +496 Mastery }
Local Legs Leggings of Biting Links
ilevel: 855, stats: { 368 Armor, +2038 Sta, +1359 AgiInt, +921 Mastery, +409 Vers }
Local Feet Black Venom Sabatons
ilevel: 865, stats: { 298 Armor, +1678 Sta, +1119 AgiInt, +718 Haste, +317 Mastery }
Local Wrists Ley Dragoon's Wristbraces
ilevel: 865, stats: { 190 Armor, +839 AgiInt, +1258 Sta, +505 Mastery, +272 Haste }
Local Hands Ley Dragoon's Gloves
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +595 Mastery, +421 Haste }
Local Finger1 Empowered Ring of the Kirin Tor
ilevel: 850, stats: { +1094 Sta, +1180 Mastery, +655 Crit }, enchant: { +150 Mastery }
Local Finger2 Nightborne Signet Ring
ilevel: 855, stats: { +1147 Sta, +1230 Mastery, +641 Haste }, enchant: { +200 Mastery }
Local Trinket1 Naraxas' Spiked Tongue
ilevel: 860, stats: { +968 Mastery }
Local Trinket2 Mana Crystal Shard
ilevel: 840, stats: { +1123 Agi, +898 Mastery }
Local Back Ragged Azsharan Sail Fragment
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +446 Mastery, +316 Haste }, enchant: { +200 Agi }
Local Main Hand Thas'dorah, Legacy of the Windrunners
ilevel: 878, weapon: { 9075 - 9077, 3 }, stats: { +1684 Agi, +2526 Sta, +737 Crit, +707 Mastery }, relics: { +43 ilevels, +42 ilevels, +43 ilevels }

Talents

Level
15 Lone Wolf (Marksmanship Hunter) Steady Focus (Marksmanship Hunter) Careful Aim (Marksmanship Hunter)
30 Lock and Load (Marksmanship Hunter) Black Arrow (Marksmanship Hunter) True Aim (Marksmanship Hunter)
45 Posthaste Farstrider Trailblazer
60 Explosive Shot (Marksmanship Hunter) Sentinel (Marksmanship Hunter) Patient Sniper (Marksmanship Hunter)
75 Binding Shot Wyvern Sting Camouflage (Marksmanship Hunter)
90 A Murder of Crows Barrage Volley
100 Sidewinders (Marksmanship Hunter) Piercing Shot (Marksmanship Hunter) Trick Shot (Marksmanship Hunter)

Profile

hunter="Sarkul"
origin="https://us.api.battle.net/wow/character/thrall/Sarkul/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/171/133787819-avatar.jpg"
level=110
race=orc
role=attack
position=ranged_back
professions=engineering=709/leatherworking=800
talents=1133121
artifact=55:0:0:0:0:307:1:308:1:310:1:311:1:312:3:313:3:314:2:315:3:318:3:319:3:320:3:321:1:322:1:1337:1
spec=marksmanship

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_seventh_demon
actions.precombat+=/food,type=fishbrul_special
actions.precombat+=/summon_pet
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/windburst

# Executed every time the actor is available.
actions=auto_shot
actions+=/arcane_torrent,if=focus.deficit>=30&(!talent.sidewinders.enabled|cooldown.sidewinders.charges<2)
actions+=/blood_fury
actions+=/berserking
actions+=/auto_shot
actions+=/variable,name=vulnerable_time,value=debuff.vulnerability.remains
actions+=/call_action_list,name=open,if=time<=15&talent.sidewinders.enabled&active_enemies=1
actions+=/call_action_list,name=cooldowns
actions+=/a_murder_of_crows,if=debuff.hunters_mark.down
actions+=/call_action_list,name=trueshotaoe,if=active_enemies>1&!talent.sidewinders.enabled&buff.trueshot.up
actions+=/barrage,if=debuff.hunters_mark.down
actions+=/black_arrow,if=debuff.hunters_mark.down
actions+=/a_murder_of_crows,if=(target.health.pct>30|target.health.pct<=20)&variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>60&focus+(focus.regen*debuff.hunters_mark.remains)>=60
actions+=/barrage,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>90&focus+(focus.regen*debuff.hunters_mark.remains)>=90
actions+=/black_arrow,if=variable.vulnerable_time>execute_time&debuff.hunters_mark.remains>execute_time&focus+(focus.regen*variable.vulnerable_time)>70&focus+(focus.regen*debuff.hunters_mark.remains)>=70
actions+=/piercing_shot,if=!talent.patient_sniper.enabled&focus>50
actions+=/windburst,if=(!talent.patient_sniper.enabled|talent.sidewinders.enabled)&(debuff.hunters_mark.down|debuff.hunters_mark.remains>execute_time&focus+(focus.regen*debuff.hunters_mark.remains)>50)
actions+=/windburst,if=talent.patient_sniper.enabled&!talent.sidewinders.enabled&((debuff.vulnerability.down|debuff.vulnerability.remains<2)|(debuff.hunters_mark.up&buff.marking_targets.up&debuff.vulnerability.down))
actions+=/call_action_list,name=targetdie,if=target.time_to_die<6&active_enemies=1
actions+=/sidewinders,if=(debuff.hunters_mark.down|(buff.marking_targets.down&buff.trueshot.down))&((buff.trueshot.react&focus<80)|charges_fractional>=1.9)
actions+=/sentinel,if=debuff.hunters_mark.down&(buff.marking_targets.down|buff.trueshot.up)
actions+=/marked_shot,target=2,if=!talent.patient_sniper.enabled&debuff.vulnerability.stack<3
actions+=/arcane_shot,if=!talent.patient_sniper.enabled&spell_targets.barrage=1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/multishot,if=!talent.patient_sniper.enabled&spell_targets.barrage>1&debuff.vulnerability.stack<3&((buff.marking_targets.up&debuff.hunters_mark.down)|buff.trueshot.up)
actions+=/arcane_shot,if=talent.steady_focus.enabled&spell_targets.barrage=1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/multishot,if=talent.steady_focus.enabled&spell_targets.barrage>1&(buff.steady_focus.down|buff.steady_focus.remains<2)
actions+=/explosive_shot
actions+=/marked_shot,if=!talent.patient_sniper.enabled|(talent.barrage.enabled&spell_targets.barrage>2)
actions+=/aimed_shot,if=debuff.hunters_mark.remains>execute_time&variable.vulnerable_time>execute_time&(buff.lock_and_load.up|(focus+debuff.hunters_mark.remains*focus.regen>=80&focus+focus.regen*variable.vulnerable_time>=80))
actions+=/aimed_shot,if=debuff.hunters_mark.down&debuff.vulnerability.remains>execute_time&(talent.sidewinders.enabled|buff.marking_targets.down|(debuff.hunters_mark.remains>execute_time+gcd&focus+5+focus.regen*debuff.hunters_mark.remains>80))
actions+=/marked_shot,if=debuff.hunters_mark.remains<1|variable.vulnerable_time<1|spell_targets.barrage>1|buff.trueshot.up
actions+=/marked_shot,if=buff.marking_targets.up&(!talent.sidewinders.enabled|cooldown.sidewinders.charges_fractional>=1.2)
actions+=/sidewinders,if=buff.marking_targets.up&debuff.hunters_mark.down&(focus<=80|(variable.vulnerable_time<2&cooldown.windburst.remains>3&cooldown.sidewinders.charges_fractional>=1.2))
actions+=/piercing_shot,if=talent.patient_sniper.enabled&focus>80
actions+=/arcane_shot,if=spell_targets.barrage=1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/multishot,if=spell_targets.barrage>1&(debuff.hunters_mark.down&buff.marking_targets.react|focus.time_to_max>=2)
actions+=/aimed_shot,if=debuff.vulnerability.down&focus>80&cooldown.windburst.remains>3
actions+=/multishot,if=spell_targets.barrage>2

actions.cooldowns=potion,name=deadly_grace,if=(buff.trueshot.react&buff.bloodlust.react)|buff.bullseye.react>=23|target.time_to_die<31
actions.cooldowns+=//trueshot,if=buff.bloodlust.react|target.time_to_die>=(cooldown+30)|buff.bullseye.react>25|target.time_to_die<16

actions.open=a_murder_of_crows
actions.open+=/trueshot
actions.open+=/sidewinders,if=(buff.marking_targets.down&buff.trueshot.remains<2)|(charges_fractional>=1.9&focus<80)
actions.open+=/marked_shot
actions.open+=/aimed_shot,if=buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.open+=/black_arrow
actions.open+=/barrage
actions.open+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.open+=/sidewinders
actions.open+=/aimed_shot
actions.open+=/arcane_shot

actions.targetdie=marked_shot
actions.targetdie+=/windburst
actions.targetdie+=/aimed_shot,if=execute_time<debuff.vulnerability.remains
actions.targetdie+=/sidewinders
actions.targetdie+=/aimed_shot
actions.targetdie+=/arcane_shot

actions.trueshotaoe=marked_shot
actions.trueshotaoe+=/piercing_shot
actions.trueshotaoe+=/barrage
actions.trueshotaoe+=/explosive_shot
actions.trueshotaoe+=/aimed_shot,if=active_enemies=2&buff.lock_and_load.up&execute_time<debuff.vulnerability.remains
actions.trueshotaoe+=/multishot

head=greyed_dragonscale_coif,id=139214,bonus_id=1807/1492/3337
neck=wolfstride_pendant,id=133633,bonus_id=1727/1502/3336,enchant=mark_of_the_hidden_satyr
shoulders=thorny_bramblemail_pauldrons,id=139218,bonus_id=1807/1808/1472,gems=150mastery
back=ragged_azsharan_sail_fragment,id=141539,bonus_id=3466/1472,enchant=200agi
chest=mountainforged_chain_hauberk,id=139597
shirt=wraps_of_the_bloodsoaked_brawler,id=98543
wrists=ley_dragoons_wristbraces,id=134296,bonus_id=3414/1527/3336
hands=ley_dragoons_gloves,id=134297,bonus_id=3397/1522/3337
waist=roar_of_the_seven_lions,id=137080,bonus_id=1811
legs=leggings_of_biting_links,id=137518,bonus_id=1727/1507/3337
feet=black_venom_sabatons,id=139219,bonus_id=1805/1487
finger1=empowered_ring_of_the_kirin_tor,id=139599,enchant=150mastery
finger2=nightborne_signet_ring,id=134279,bonus_id=3432/1517/3337,enchant=200mastery
trinket1=naraxas_spiked_tongue,id=137349,bonus_id=3412/1512/3336
trinket2=mana_crystal_shard,id=134335,bonus_id=3432/605/1502/3336
main_hand=thasdorah_legacy_of_the_windrunners,id=128826,bonus_id=727,gem_id=137008/139254/136973/0,relic_id=1807:1472/3379:1467:3336/1727:1502:3336/0

# Gear Summary
# gear_ilvl=860.20
# gear_agility=13505
# gear_stamina=21604
# gear_crit_rating=2005
# gear_haste_rating=4531
# gear_mastery_rating=12180
# gear_versatility_rating=409
# gear_armor=2608
summon_pet=cat

Mellarene

Mellarene : 383317 dps, 257925 dps to main target

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
383316.5 383316.5 470.4 / 0.123% 91669.1 / 23.9% 23.5
RPS Out RPS In Primary Resource Waiting APM Active Skill
16214.9 16214.9 Mana 2.94% 49.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Mellarene/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • alchemy: 408
  • herbalism: 795
Scale Factors for Mellarene Damage Per Second
Haste Crit Int Vers Mastery
Scale Factors 13.91 11.06 10.55 9.11 6.16
Normalized 1.32 1.05 1.00 0.86 0.58
Scale Deltas 1138 1138 1138 1138 1138
Error 0.60 0.59 0.59 0.59 0.58
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int > Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.55, CritRating=11.06, HasteRating=13.91, MasteryRating=6.16, Versatility=9.11 )

Scale Factors for other metrics

Scale Factors for Mellarene Damage Per Second
Haste Crit Int Vers Mastery
Scale Factors 13.91 11.06 10.55 9.11 6.16
Normalized 1.32 1.05 1.00 0.86 0.58
Scale Deltas 1138 1138 1138 1138 1138
Error 0.60 0.59 0.59 0.59 0.58
Gear Ranking
Optimizers
Ranking
  • Haste > Crit ~= Int > Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.55, CritRating=11.06, HasteRating=13.91, MasteryRating=6.16, Versatility=9.11 )
Scale Factors for Mellarene Priority Target Damage Per Second
Crit Haste Int Vers Mastery
Scale Factors 10.53 9.12 7.66 6.12 5.80
Normalized 1.38 1.19 1.00 0.80 0.76
Scale Deltas 1138 1138 1138 1138 1138
Error 0.27 0.27 0.27 0.27 0.27
Gear Ranking
Optimizers
Ranking
  • Crit > Haste > Int > Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=7.66, CritRating=10.53, HasteRating=9.12, MasteryRating=5.80, Versatility=6.12 )
Scale Factors for Mellarene Damage Per Second (Effective)
Haste Crit Int Vers Mastery
Scale Factors 13.91 11.06 10.55 9.11 6.16
Normalized 1.32 1.05 1.00 0.86 0.58
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Crit > Int > Vers > Mastery
Pawn string ( Pawn: v1: "Mellarene": Intellect=10.55, CritRating=11.06, HasteRating=13.91, MasteryRating=6.16, Versatility=9.11 )
Scale Factors for Mellarene Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for Mellarene Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )
Scale Factors for MellareneTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Mellarene": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Mellarene 383317
Conflagration (_dot) 774 0.2% 92.9 4.11sec 3340 0 Periodic 176.9 1755 0 1755 0.0% 86.6%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 92.94 0.00 176.88 176.88 0.0000 1.9596 310407.05 310407.05 0.00 895.52 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 176.9 100.00% 1754.88 1 2531 1754.41 1678 1842 310407 310407 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 20184 5.2% 63.8 6.11sec 125212 0 Direct 282.9 14288 34619 28224 68.5%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 63.78 282.93 0.00 0.00 0.0000 0.0000 7985562.07 7985562.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 89.00 31.46% 14288.50 13498 20248 14307.02 13498 16655 1271714 1271714 0.00
crit 193.93 68.54% 34619.16 27807 52138 34667.80 30541 42502 6713848 6713848 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 10971 2.8% 20.9 5.37sec 207023 0 Direct 20.9 85962 235513 207391 81.2%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.91 20.88 0.00 0.00 0.0000 0.0000 4329559.19 4329559.19 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.93 18.81% 85961.50 81057 121586 85196.65 0 121586 337496 337496 0.00
crit 16.95 81.19% 235513.44 162115 303965 235709.70 198590 283701 3992064 3992064 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 15659 4.1% 45.5 8.87sec 137747 0 Direct 45.5 0 137746 137746 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.48 45.48 0.00 0.00 0.0000 0.0000 6265082.70 6265082.70 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.48 100.00% 137746.34 97316 182467 137740.11 120428 154192 6265083 6265083 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 29236 7.7% 93.1 4.11sec 126066 67858 Direct 92.9 65128 147648 126275 74.1%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 93.10 92.94 0.00 0.00 1.8578 0.0000 11736390.32 11736390.32 0.00 67857.67 67857.67
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.07 25.90% 65128.47 64367 96550 65122.30 64367 72413 1567868 1567868 0.00
crit 68.87 74.10% 147648.06 132595 248616 147624.71 138549 159062 10168522 10168522 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 54172 14.2% 301.5 1.36sec 71907 0 Periodic 637.0 34028 0 34028 0.0% 159.1%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 301.47 0.00 637.04 637.04 0.0000 1.0000 21678131.41 21678131.41 0.00 34029.41 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 637.0 100.00% 34028.13 763 236495 34322.56 21453 49173 21678131 21678131 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Living Bomb 12298 3.2% 87.3 9.25sec 55590 199089 Periodic 297.9 8647 20202 16294 66.2% 65.3%

Stats details: living_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.32 0.00 297.93 297.93 0.2792 0.8784 4854388.93 4854388.93 0.00 16968.64 199089.08
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 100.8 33.82% 8647.02 8437 12655 8644.18 8437 9418 871340 871340 0.00
crit 197.2 66.18% 20201.96 17380 32588 20199.36 18386 22989 3983049 3983049 0.00
 
 

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&buff.combustion.down
Spelldata
  • id:44457
  • name:Living Bomb
  • school:fire
  • tooltip:Causes $w1 Fire damage every $t1 sec. After {$d=0 milliseconds}, the target explodes, causing $w2 Fire damage to the target and all other enemies within $44461A2 yards$?$w3>0[, and spreading Living Bomb][].
  • description:The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Living Bomb (_explosion) 62831 16.2% 87.3 9.24sec 283982 0 Direct 472.8 27701 65057 52446 66.2%  

Stats details: living_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 87.32 472.84 0.00 0.00 0.0000 0.0000 24798634.01 24798634.01 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 159.63 33.76% 27701.04 26996 40494 27694.46 26996 30332 4421956 4421956 0.00
crit 313.21 66.24% 65056.81 55611 104271 65030.08 58182 74988 20376678 20376678 0.00
 
 

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:44461
  • name:Living Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc44457=The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mark of the Hidden Satyr 9430 2.5% 21.3 18.61sec 176968 0 Direct 21.3 87215 216151 176966 69.6%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.33 21.33 0.00 0.00 0.0000 0.0000 3774802.58 3774802.58 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.48 30.39% 87215.38 83439 125158 87084.67 0 125158 565391 565391 0.00
crit 14.85 69.61% 216150.69 171884 322282 216085.91 175106 292984 3209411 3209411 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
Phoenix Reborn 3597 0.9% 40.2 9.72sec 35717 0 Direct 40.2 17695 43678 35718 69.4%  

Stats details: phoenix_reborn

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.22 40.22 0.00 0.00 0.0000 0.0000 1436619.16 1436619.16 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.32 30.64% 17695.46 16872 25308 17705.29 16872 21933 218058 218058 0.00
crit 27.90 69.36% 43677.63 34756 65167 43726.21 38231 52031 1218561 1218561 0.00
 
 

Action details: phoenix_reborn

Static Values
  • id:215773
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:215773
  • name:Phoenix Reborn
  • school:fire
  • tooltip:
  • description:Targets affected by your Ignite have a chance to erupt in flame, taking $215775m1 additional Fire damage and reducing the remaining cooldown on Phoenix's Flame by {$s1=10} sec.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Phoenix's Flames 15358 4.0% 19.2 21.41sec 318551 240683 Direct 19.2 0 319380 319380 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.24 19.19 0.00 0.00 1.3236 0.0000 6130199.98 6130199.98 0.00 240683.16 240683.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 19.19 100.00% 319379.61 208536 391006 319525.03 272661 371072 6130200 6130200 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phoenix's Flames (_splash) 10187 2.6% 19.2 21.45sec 209520 0 Direct 40.8 0 98467 98467 100.0%  

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.19 40.84 0.00 0.00 0.0000 0.0000 4021577.89 4021577.89 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 40.84 100.00% 98466.74 72987 130334 99154.99 80981 121645 4021578 4021578 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Pyroblast 88840 23.3% 102.2 3.92sec 348028 261579 Direct 103.0 147009 395381 345280 79.8%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 102.20 103.02 0.00 0.00 1.3305 0.0000 35569971.10 35569971.10 0.00 261578.53 261578.53
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.78 20.17% 147009.36 137026 205539 147046.58 137026 171283 3054738 3054738 0.00
crit 82.24 79.83% 395381.35 282274 529264 395333.53 362913 437666 32515233 32515233 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 14 0.0% 0.1 82.79sec 52562 34915 Direct 0.1 0 52562 52562 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 0.11 0.11 0.00 0.00 1.5071 0.0000 5656.28 5656.28 0.00 34915.30 34915.30
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 0.11 100.00% 52562.39 34758 65171 5328.77 0 65171 5656 5656 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Tormenting Cyclone 18283 4.7% 12.7 30.29sec 568893 0 Direct 306.8 12279 28842 23610 68.4%  

Stats details: tormenting_cyclone

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.73 306.76 0.00 0.00 0.0000 0.0000 7242845.51 7242845.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 96.89 31.58% 12278.69 11881 17822 12275.98 11881 15033 1189659 1189659 0.00
crit 209.88 68.42% 28841.52 23762 44554 28839.14 24752 37042 6053186 6053186 0.00
 
 

Action details: tormenting_cyclone

Static Values
  • id:221857
  • school:shadow
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221857
  • name:Tormenting Cyclone
  • school:shadow
  • tooltip:
  • description:{$@spelldesc221845=Your ranged attacks and spells have a chance to create a Tormenting Cyclone at the target's location for {$221857d=10 seconds} that deals {$s1=7995} Shadow damage every sec.}
 
Volatile Ichor 31481 8.2% 16.9 23.22sec 739621 0 Direct 57.0 114738 267901 218645 67.8%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.86 57.05 0.00 0.00 0.0000 0.0000 12473624.94 12473624.94 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.35 32.16% 114738.24 111139 166708 114751.40 111139 148185 2105076 2105076 0.00
crit 38.70 67.84% 267901.24 222277 416770 267815.29 226493 352986 10368549 10368549 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:108554.62
  • base_dd_max:108554.62
 
Simple Action Stats Execute Interval
Mellarene
Arcane Torrent 3.7 122.45sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.66 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
Combustion 5.4 82.13sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.38 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 9.7 42.87sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.8 78.95sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.77 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Mellarene
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 9.1 47.83sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.14 0.00 0.00 0.00 1.5252 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 40.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.4 0.0 82.1sec 82.1sec 13.28% 90.50% 106.2(106.2) 5.2

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:13.28%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 20.3 3.7 18.6sec 15.6sec 23.50% 24.81% 0.0(0.0) 1.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:20.64%
  • enhanced_pyrotechnics_2:2.69%
  • enhanced_pyrotechnics_3:0.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 110.9 0.0 3.6sec 3.6sec 41.27% 48.01% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:41.27%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 102.4 0.0 3.9sec 3.9sec 23.04% 99.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:23.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 80.3sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 37.9 178.0 10.6sec 1.9sec 77.17% 100.00% 88.6(88.6) 1.3

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:16.86%
  • pyretic_incantation_2:9.65%
  • pyretic_incantation_3:6.72%
  • pyretic_incantation_4:8.50%
  • pyretic_incantation_5:35.44%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 9.1 0.0 47.8sec 47.8sec 14.80% 14.80% 0.0(0.0) 2.4

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:14.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Mellarene
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Mellarene
combustion Mana 5.4 591479.6 110000.0 109996.9 0.0
counterspell Mana 9.7 213800.1 22000.0 22000.5 0.0
fire_blast Mana 45.5 500304.8 11000.0 10999.9 12.5
fireball Mana 93.1 2048135.6 22000.0 22000.0 5.7
living_bomb Mana 18.2 300513.4 16500.0 3441.3 16.2
pyroblast Mana 103.2 2838083.6 27500.0 27768.7 12.5
scorch Mana 0.1 1183.2 11000.0 10995.6 4.8
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 3.66 119916.59 (1.87%) 32753.34 903.07 0.75%
mp5_regen Mana 832.64 6295081.57 (98.13%) 7560.41 305560.04 4.63%
Resource RPS-Gain RPS-Loss
Mana 16018.83 16214.93
Combat End Resource Mean Min Max
Mana 1020461.74 865309.50 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 2.0%

Procs

Count Interval
Heating Up generated 110.9 3.6sec
Heating Up removed 8.0 42.3sec
IB conversions of HU 43.8 9.2sec
Total Hot Streak procs 102.4 3.9sec
Hot Streak spells used 260.7 1.5sec
Hot Streak spell crits 215.9 1.9sec
Wasted Hot Streak spell crits 2.6 73.5sec
Direct Ignite applications 26.7 46.7sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Mellarene Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Mellarene Damage Per Second
Count 9999
Mean 383316.52
Minimum 313749.61
Maximum 492037.98
Spread ( max - min ) 178288.36
Range [ ( max - min ) / 2 * 100% ] 23.26%
Standard Deviation 24001.2383
5th Percentile 347553.93
95th Percentile 425274.94
( 95th Percentile - 5th Percentile ) 77721.01
Mean Distribution
Standard Deviation 240.0244
95.00% Confidence Intervall ( 382846.08 - 383786.96 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 150
0.1% Error 15060
0.1 Scale Factor Error with Delta=300 4917574
0.05 Scale Factor Error with Delta=300 19670298
0.01 Scale Factor Error with Delta=300 491757472
Priority Target DPS
Sample Data Mellarene Priority Target Damage Per Second
Count 9999
Mean 257925.45
Minimum 224950.98
Maximum 299823.29
Spread ( max - min ) 74872.30
Range [ ( max - min ) / 2 * 100% ] 14.51%
Standard Deviation 10858.1039
5th Percentile 242182.36
95th Percentile 277545.90
( 95th Percentile - 5th Percentile ) 35363.53
Mean Distribution
Standard Deviation 108.5865
95.00% Confidence Intervall ( 257712.62 - 258138.27 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 68
0.1% Error 6807
0.1 Scale Factor Error with Delta=300 1006448
0.05 Scale Factor Error with Delta=300 4025794
0.01 Scale Factor Error with Delta=300 100644872
DPS(e)
Sample Data Mellarene Damage Per Second (Effective)
Count 9999
Mean 383316.52
Minimum 313749.61
Maximum 492037.98
Spread ( max - min ) 178288.36
Range [ ( max - min ) / 2 * 100% ] 23.26%
Damage
Sample Data Mellarene Damage
Count 9999
Mean 152613453.10
Minimum 118349093.35
Maximum 191011579.34
Spread ( max - min ) 72662485.99
Range [ ( max - min ) / 2 * 100% ] 23.81%
DTPS
Sample Data Mellarene Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Mellarene Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Mellarene Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Mellarene Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Mellarene Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Mellarene Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MellareneTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Mellarene Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 9.72 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 6.28 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.77 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
D 18.22 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
E 4.75 rune_of_power,if=buff.combustion.down
F 0.00 call_action_list,name=active_talents
G 5.38 combustion
H 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
I 3.66 arcane_torrent
J 31.80 pyroblast,if=buff.hot_streak.up
K 20.96 fire_blast,if=buff.heating_up.up
L 11.76 phoenixs_flames
M 0.15 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 10.44 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 5.69 fire_blast,if=!prev_off_gcd.fire_blast
Q 5.34 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
R 3.58 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
S 1.80 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
T 59.96 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
U 0.00 call_action_list,name=active_talents
V 0.22 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
W 18.62 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
X 0.35 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Y 106.88 fireball

Sample Sequence

01256EGILKJKCJ7KJKJLJLJY8PNRQNRDYYTYTWYTDYWTYYYY7YTYTYDYYWTYYYDTWYSTYYYYYDYSEGHJKJKCJIKJKJLJLTYYYYYTDWTY7YYY8NPNDYYTWYTYTYYTDYYWTYTY7STDYYTYYEGJKJKCJKJKJLJLTDYYTYT7WYTYTYTYTDWT8PNQNQRRNDTYYYY7WTYYDWTYYTYYYYDYYEGIJKJKCJKJKJLJLT7DYYYYYWTYYDYY8PQNPNDYYYYT7YYTDWTYWTYTYYYYYYTYTYTYEGJ7KJKCJKJIKJLJLTYYTYTWYTYYYY8NPNQN7PQNQRYY8NPNCPRPNRR

Sample Sequence Table

time name target resources buffs
Pre flask Mellarene 1100000.0/1100000: 100% mana
Pre food Mellarene 1100000.0/1100000: 100% mana
Pre augmentation Mellarene 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.374 combustion Fluffy_Pillow 1095171.0/1100000: 100% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.374 arcane_torrent Fluffy_Pillow 985171.0/1100000: 90% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.374 phoenixs_flames Fluffy_Pillow 1018171.0/1100000: 93% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:02.430 fire_blast Fluffy_Pillow 1035595.0/1100000: 94% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:02.430 pyroblast Fluffy_Pillow 1024595.0/1100000: 93% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:03.487 fire_blast Fluffy_Pillow 1014535.5/1100000: 92% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:03.487 flame_on Fluffy_Pillow 1003535.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:03.487 pyroblast Fluffy_Pillow 1003535.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:04.545 counterspell Fluffy_Pillow 993492.5/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.545 fire_blast Fluffy_Pillow 971492.5/1100000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.545 pyroblast Fluffy_Pillow 960492.5/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.600 fire_blast Fluffy_Pillow 950400.0/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.600 pyroblast Fluffy_Pillow 939400.0/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:06.659 phoenixs_flames Fluffy_Pillow 929373.5/1100000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.717 pyroblast Fluffy_Pillow 946830.5/1100000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.775 phoenixs_flames Fluffy_Pillow 936787.5/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.834 pyroblast Fluffy_Pillow 954261.0/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:10.892 fireball Fluffy_Pillow 944218.0/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:12.006 Waiting 1.200 sec 962599.0/1100000: 88% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.206 rune_of_power Fluffy_Pillow 982399.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.263 fire_blast Fluffy_Pillow 999839.5/1100000: 91% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:14.263 pyroblast Fluffy_Pillow 988839.5/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:15.320 fireball Fluffy_Pillow 978780.0/1100000: 89% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:16.713 phoenixs_flames Fluffy_Pillow 979764.5/1100000: 89% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:17.771 pyroblast Fluffy_Pillow 997221.5/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:18.829 fireball Fluffy_Pillow 987178.5/1100000: 90% mana bloodlust, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:20.004 living_bomb Fluffy_Pillow 1006566.0/1100000: 92% mana bloodlust, raid_movement, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:21.059 Waiting 2.600 sec 1007473.5/1100000: 92% mana bloodlust, raid_movement, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:23.659 fireball Fluffy_Pillow 1050373.5/1100000: 95% mana bloodlust, heating_up, pyretic_incantation(3)
0:25.054 fireball Fluffy_Pillow 1051391.0/1100000: 96% mana bloodlust, heating_up
0:26.448 pyroblast Fluffy_Pillow 1052392.0/1100000: 96% mana bloodlust, hot_streak, pyretic_incantation
0:27.504 fireball Fluffy_Pillow 1042316.0/1100000: 95% mana bloodlust, hot_streak, pyretic_incantation(3)
0:28.560 pyroblast Fluffy_Pillow 1059740.0/1100000: 96% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(3)
0:29.618 fire_blast Fluffy_Pillow 1049697.0/1100000: 95% mana bloodlust, heating_up, pyretic_incantation(4)
0:29.618 fireball Fluffy_Pillow 1038697.0/1100000: 94% mana bloodlust, hot_streak, pyretic_incantation(5)
0:31.013 pyroblast Fluffy_Pillow 1039714.5/1100000: 95% mana bloodlust, hot_streak, pyretic_incantation(5)
0:32.073 living_bomb Fluffy_Pillow 1029704.5/1100000: 94% mana bloodlust, heating_up
0:33.132 fireball Fluffy_Pillow 1030678.0/1100000: 94% mana bloodlust, heating_up
0:34.526 fire_blast Fluffy_Pillow 1031679.0/1100000: 94% mana bloodlust, heating_up
0:34.526 pyroblast Fluffy_Pillow 1020679.0/1100000: 93% mana bloodlust, hot_streak, pyretic_incantation
0:35.583 fireball Fluffy_Pillow 1010619.5/1100000: 92% mana bloodlust, enhanced_pyrotechnics
0:36.978 fireball Fluffy_Pillow 1011637.0/1100000: 92% mana bloodlust, enhanced_pyrotechnics
0:38.369 fireball Fluffy_Pillow 1012588.5/1100000: 92% mana bloodlust, heating_up, pyretic_incantation
0:39.762 fireball Fluffy_Pillow 1013573.0/1100000: 92% mana bloodlust, enhanced_pyrotechnics
0:41.155 counterspell Fluffy_Pillow 1014557.5/1100000: 92% mana heating_up, pyretic_incantation
0:41.155 fireball Fluffy_Pillow 992557.5/1100000: 90% mana heating_up, pyretic_incantation
0:42.965 pyroblast Fluffy_Pillow 1000422.5/1100000: 91% mana hot_streak, pyretic_incantation(2)
0:44.338 Waiting 0.900 sec 995577.0/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(4)
0:45.238 fireball Fluffy_Pillow 1010427.0/1100000: 92% mana hot_streak, pyretic_incantation(4)
0:47.046 pyroblast Fluffy_Pillow 1018259.0/1100000: 93% mana hot_streak, pyretic_incantation(4)
0:48.421 fireball Fluffy_Pillow 1013446.5/1100000: 92% mana enhanced_pyrotechnics
0:50.004 living_bomb Fluffy_Pillow 1039566.0/1100000: 95% mana raid_movement, enhanced_pyrotechnics
0:51.377 Waiting 2.200 sec 1045720.5/1100000: 95% mana raid_movement, enhanced_pyrotechnics
0:53.577 fireball Fluffy_Pillow 1082020.5/1100000: 98% mana enhanced_pyrotechnics
0:55.389 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
0:57.199 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
0:57.199 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
0:58.571 fireball Fluffy_Pillow 1062204.0/1100000: 97% mana enhanced_pyrotechnics
1:00.003 Waiting 1.200 sec 1085832.0/1100000: 99% mana raid_movement, enhanced_pyrotechnics
1:01.203 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:03.013 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
1:04.823 living_bomb Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
1:06.197 pyroblast Fluffy_Pillow 1084237.0/1100000: 99% mana hot_streak, pyretic_incantation(2)
1:07.570 fire_blast Fluffy_Pillow 1079391.5/1100000: 98% mana heating_up, pyretic_incantation(3)
1:07.570 fireball Fluffy_Pillow 1068391.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
1:09.381 phoenixs_flames Fluffy_Pillow 1076273.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
1:10.756 pyroblast Fluffy_Pillow 1098960.5/1100000: 100% mana hot_streak, pyretic_incantation(5)
1:12.128 fireball Fluffy_Pillow 1094098.5/1100000: 99% mana heating_up, pyretic_incantation(5)
1:13.940 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation(5)
1:15.751 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
1:17.127 Waiting 0.100 sec 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation
1:17.227 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana heating_up, pyretic_incantation
1:19.038 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
1:20.413 living_bomb Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
1:21.786 Waiting 1.800 sec 1100000.0/1100000: 100% mana raid_movement, enhanced_pyrotechnics
1:23.586 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics
1:25.396 phoenixs_flames Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
1:26.769 rune_of_power Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2)
1:28.142 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2), rune_of_power
1:28.142 potion Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
1:28.142 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
1:29.515 fire_blast Fluffy_Pillow 985154.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
1:29.515 pyroblast Fluffy_Pillow 974154.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
1:30.889 fire_blast Fluffy_Pillow 969325.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:30.889 flame_on Fluffy_Pillow 958325.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:30.889 pyroblast Fluffy_Pillow 958325.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.262 arcane_torrent Fluffy_Pillow 953480.0/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.262 fire_blast Fluffy_Pillow 986480.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.262 pyroblast Fluffy_Pillow 975480.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:33.637 fire_blast Fluffy_Pillow 970667.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:33.637 pyroblast Fluffy_Pillow 959667.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.012 phoenixs_flames Fluffy_Pillow 954855.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:36.386 pyroblast Fluffy_Pillow 977526.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:37.761 phoenixs_flames Fluffy_Pillow 972713.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:39.135 pyroblast Fluffy_Pillow 995384.5/1100000: 90% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:40.508 fireball Fluffy_Pillow 990539.0/1100000: 90% mana potion_of_deadly_grace
1:42.317 fireball Fluffy_Pillow 998387.5/1100000: 91% mana potion_of_deadly_grace
1:44.126 fireball Fluffy_Pillow 1006236.0/1100000: 91% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:45.935 fireball Fluffy_Pillow 1014084.5/1100000: 92% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:47.745 fireball Fluffy_Pillow 1021949.5/1100000: 93% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:49.119 pyroblast Fluffy_Pillow 1044620.5/1100000: 95% mana raid_movement, hot_streak, pyretic_incantation(2), potion_of_deadly_grace
1:50.493 living_bomb Fluffy_Pillow 1039791.5/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:51.865 fire_blast Fluffy_Pillow 1045929.5/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(3), potion_of_deadly_grace
1:51.865 pyroblast Fluffy_Pillow 1034929.5/1100000: 94% mana raid_movement, hot_streak, pyretic_incantation(4), potion_of_deadly_grace
1:53.239 Waiting 0.400 sec 1030100.5/1100000: 94% mana raid_movement, heating_up, pyretic_incantation(5)
1:53.639 fireball Fluffy_Pillow 1036700.5/1100000: 94% mana heating_up, pyretic_incantation(5)
1:55.449 counterspell Fluffy_Pillow 1044565.5/1100000: 95% mana heating_up, pyretic_incantation(5)
1:55.449 fireball Fluffy_Pillow 1022565.5/1100000: 93% mana heating_up, pyretic_incantation(5)
1:57.259 fireball Fluffy_Pillow 1030430.5/1100000: 94% mana enhanced_pyrotechnics
1:59.069 fireball Fluffy_Pillow 1038295.5/1100000: 94% mana heating_up, pyretic_incantation
2:00.879 rune_of_power Fluffy_Pillow 1046160.5/1100000: 95% mana hot_streak, pyretic_incantation(2)
2:02.253 pyroblast Fluffy_Pillow 1068831.5/1100000: 97% mana hot_streak, pyretic_incantation(3), rune_of_power
2:03.626 fire_blast Fluffy_Pillow 1063986.0/1100000: 97% mana heating_up, pyretic_incantation(4), rune_of_power
2:03.626 pyroblast Fluffy_Pillow 1052986.0/1100000: 96% mana hot_streak, pyretic_incantation(5), rune_of_power
2:05.000 living_bomb Fluffy_Pillow 1048157.0/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(5), rune_of_power
2:06.468 fireball Fluffy_Pillow 1055879.0/1100000: 96% mana heating_up, pyretic_incantation(5)
2:08.279 fireball Fluffy_Pillow 1063760.5/1100000: 97% mana heating_up, pyretic_incantation(5)
2:10.088 pyroblast Fluffy_Pillow 1071609.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
2:11.463 fire_blast Fluffy_Pillow 1066796.5/1100000: 97% mana heating_up
2:11.463 fireball Fluffy_Pillow 1055796.5/1100000: 96% mana hot_streak, pyretic_incantation
2:13.273 pyroblast Fluffy_Pillow 1063661.5/1100000: 97% mana hot_streak, pyretic_incantation
2:14.648 fireball Fluffy_Pillow 1058849.0/1100000: 96% mana hot_streak, pyretic_incantation(3)
2:16.460 pyroblast Fluffy_Pillow 1066747.0/1100000: 97% mana hot_streak, pyretic_incantation(3)
2:17.835 fireball Fluffy_Pillow 1061934.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:19.647 fireball Fluffy_Pillow 1069832.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:21.021 pyroblast Fluffy_Pillow 1092503.5/1100000: 99% mana hot_streak, pyretic_incantation(2)
2:22.394 living_bomb Fluffy_Pillow 1087658.0/1100000: 99% mana
2:23.769 fireball Fluffy_Pillow 1093845.5/1100000: 99% mana
2:25.579 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana
2:27.388 fire_blast Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
2:27.388 pyroblast Fluffy_Pillow 1067049.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:28.762 fireball Fluffy_Pillow 1062220.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:30.572 pyroblast Fluffy_Pillow 1070085.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:31.946 fireball Fluffy_Pillow 1065256.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
2:33.755 counterspell Fluffy_Pillow 1073105.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:33.755 phoenixs_flames Fluffy_Pillow 1051105.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
2:35.127 pyroblast Fluffy_Pillow 1073743.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:36.502 Waiting 0.300 sec 1068930.5/1100000: 97% mana raid_movement, heating_up, pyretic_incantation(5)
2:36.802 living_bomb Fluffy_Pillow 1073880.5/1100000: 98% mana raid_movement, heating_up, pyretic_incantation(5)
2:38.366 fireball Fluffy_Pillow 1083186.5/1100000: 98% mana heating_up, pyretic_incantation(5)
2:40.177 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(5)
2:41.987 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
2:43.360 fireball Fluffy_Pillow 1073220.5/1100000: 98% mana heating_up
2:45.171 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up
2:46.983 rune_of_power Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation
2:48.356 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(2), rune_of_power
2:48.356 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(2), rune_of_power
2:49.729 fire_blast Fluffy_Pillow 985154.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(3), rune_of_power
2:49.729 pyroblast Fluffy_Pillow 974154.5/1100000: 89% mana combustion, hot_streak, pyretic_incantation(4), rune_of_power
2:51.103 fire_blast Fluffy_Pillow 969325.5/1100000: 88% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power
2:51.103 flame_on Fluffy_Pillow 958325.5/1100000: 87% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:51.103 pyroblast Fluffy_Pillow 958325.5/1100000: 87% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:52.475 fire_blast Fluffy_Pillow 953463.5/1100000: 87% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
2:52.475 pyroblast Fluffy_Pillow 942463.5/1100000: 86% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
2:53.849 fire_blast Fluffy_Pillow 937634.5/1100000: 85% mana combustion, heating_up, pyretic_incantation(5)
2:53.849 pyroblast Fluffy_Pillow 926634.5/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5)
2:55.225 phoenixs_flames Fluffy_Pillow 921838.5/1100000: 84% mana combustion, heating_up, pyretic_incantation(5)
2:56.599 pyroblast Fluffy_Pillow 944509.5/1100000: 86% mana combustion, hot_streak, pyretic_incantation(5)
2:57.970 phoenixs_flames Fluffy_Pillow 939631.0/1100000: 85% mana combustion, heating_up, pyretic_incantation(5)
2:59.343 pyroblast Fluffy_Pillow 962285.5/1100000: 87% mana hot_streak, pyretic_incantation(5)
3:00.715 living_bomb Fluffy_Pillow 957423.5/1100000: 87% mana heating_up, pyretic_incantation(5)
3:02.088 fireball Fluffy_Pillow 963578.0/1100000: 88% mana heating_up, pyretic_incantation(5)
3:03.899 fireball Fluffy_Pillow 971459.5/1100000: 88% mana heating_up, pyretic_incantation(5)
3:05.708 pyroblast Fluffy_Pillow 979308.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:07.080 fireball Fluffy_Pillow 974446.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
3:08.454 pyroblast Fluffy_Pillow 997117.0/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(5)
3:09.827 counterspell Fluffy_Pillow 992271.5/1100000: 90% mana heating_up, pyretic_incantation(5)
3:09.827 fire_blast Fluffy_Pillow 970271.5/1100000: 88% mana heating_up, pyretic_incantation(5)
3:09.827 fireball Fluffy_Pillow 959271.5/1100000: 87% mana hot_streak, pyretic_incantation(5)
3:11.638 pyroblast Fluffy_Pillow 967153.0/1100000: 88% mana hot_streak, pyretic_incantation(5)
3:13.012 fireball Fluffy_Pillow 962324.0/1100000: 87% mana hot_streak, pyretic_incantation(5)
3:14.823 pyroblast Fluffy_Pillow 970205.5/1100000: 88% mana hot_streak, pyretic_incantation(5)
3:16.198 fireball Fluffy_Pillow 965393.0/1100000: 88% mana hot_streak, pyretic_incantation(5)
3:18.008 pyroblast Fluffy_Pillow 973258.0/1100000: 88% mana hot_streak, pyretic_incantation(5)
3:19.382 fireball Fluffy_Pillow 968429.0/1100000: 88% mana hot_streak, pyretic_incantation(5)
3:20.755 pyroblast Fluffy_Pillow 991083.5/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
3:22.130 living_bomb Fluffy_Pillow 986271.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
3:23.502 fire_blast Fluffy_Pillow 992409.0/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5)
3:23.502 pyroblast Fluffy_Pillow 981409.0/1100000: 89% mana raid_movement, hot_streak, pyretic_incantation(5)
3:24.875 Waiting 0.300 sec 976563.5/1100000: 89% mana raid_movement, heating_up, pyretic_incantation(5)
3:25.175 rune_of_power Fluffy_Pillow 981513.5/1100000: 89% mana heating_up, pyretic_incantation(5)
3:26.548 fire_blast Fluffy_Pillow 1004168.0/1100000: 91% mana heating_up, pyretic_incantation(5), rune_of_power
3:26.548 pyroblast Fluffy_Pillow 993168.0/1100000: 90% mana hot_streak, pyretic_incantation(5), rune_of_power
3:27.921 phoenixs_flames Fluffy_Pillow 988322.5/1100000: 90% mana heating_up, pyretic_incantation(5), rune_of_power
3:29.296 pyroblast Fluffy_Pillow 1011010.0/1100000: 92% mana hot_streak, pyretic_incantation(5), rune_of_power
3:30.670 phoenixs_flames Fluffy_Pillow 1006181.0/1100000: 91% mana rune_of_power
3:32.044 fireball Fluffy_Pillow 1028852.0/1100000: 94% mana heating_up, pyretic_incantation, rune_of_power
3:33.855 fireball Fluffy_Pillow 1036733.5/1100000: 94% mana heating_up, pyretic_incantation, rune_of_power
3:35.666 pyroblast Fluffy_Pillow 1044615.0/1100000: 95% mana hot_streak, pyretic_incantation(2), rune_of_power
3:37.039 living_bomb Fluffy_Pillow 1039769.5/1100000: 95% mana hot_streak, pyretic_incantation(4)
3:38.412 pyroblast Fluffy_Pillow 1045924.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
3:39.785 fireball Fluffy_Pillow 1041078.5/1100000: 95% mana
3:41.159 fireball Fluffy_Pillow 1063749.5/1100000: 97% mana
3:42.970 fireball Fluffy_Pillow 1071631.0/1100000: 97% mana
3:44.780 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics
3:46.591 counterspell Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
3:46.591 fire_blast Fluffy_Pillow 1056082.5/1100000: 96% mana heating_up, pyretic_incantation
3:46.591 pyroblast Fluffy_Pillow 1045082.5/1100000: 95% mana hot_streak, pyretic_incantation(2)
3:47.964 fireball Fluffy_Pillow 1040237.0/1100000: 95% mana enhanced_pyrotechnics
3:49.774 fireball Fluffy_Pillow 1048102.0/1100000: 95% mana enhanced_pyrotechnics
3:51.147 living_bomb Fluffy_Pillow 1070756.5/1100000: 97% mana raid_movement, heating_up, pyretic_incantation
3:52.519 fire_blast Fluffy_Pillow 1076894.5/1100000: 98% mana raid_movement, heating_up, pyretic_incantation
3:52.519 pyroblast Fluffy_Pillow 1065894.5/1100000: 97% mana raid_movement, hot_streak, pyretic_incantation(2)
3:53.893 fireball Fluffy_Pillow 1061065.5/1100000: 96% mana heating_up, pyretic_incantation(3)
3:55.704 fireball Fluffy_Pillow 1068947.0/1100000: 97% mana heating_up, pyretic_incantation(3)
3:57.078 pyroblast Fluffy_Pillow 1091618.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(4)
3:58.450 fireball Fluffy_Pillow 1086756.0/1100000: 99% mana
4:00.262 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana
4:02.071 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics
4:03.882 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
4:05.693 living_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
4:07.120 fireball Fluffy_Pillow 1085128.0/1100000: 99% mana heating_up, pyretic_incantation
4:08.931 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
4:10.740 rune_of_power Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
4:12.116 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(3)
4:12.116 arcane_torrent Fluffy_Pillow 990000.0/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(3)
4:12.116 pyroblast Fluffy_Pillow 1023000.0/1100000: 93% mana raid_movement, combustion, hot_streak, pyretic_incantation(3)
4:13.487 fire_blast Fluffy_Pillow 1018121.5/1100000: 93% mana combustion, heating_up, pyretic_incantation(4)
4:13.487 pyroblast Fluffy_Pillow 1007121.5/1100000: 92% mana combustion, hot_streak, pyretic_incantation(5)
4:14.861 fire_blast Fluffy_Pillow 1002292.5/1100000: 91% mana combustion, heating_up, pyretic_incantation(5)
4:14.861 flame_on Fluffy_Pillow 991292.5/1100000: 90% mana combustion, hot_streak, pyretic_incantation(5)
4:14.861 pyroblast Fluffy_Pillow 991292.5/1100000: 90% mana combustion, hot_streak, pyretic_incantation(5)
4:16.234 fire_blast Fluffy_Pillow 986447.0/1100000: 90% mana combustion, heating_up, pyretic_incantation(5)
4:16.234 pyroblast Fluffy_Pillow 975447.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5)
4:17.608 fire_blast Fluffy_Pillow 970618.0/1100000: 88% mana combustion, heating_up, pyretic_incantation(5)
4:17.608 pyroblast Fluffy_Pillow 959618.0/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5)
4:18.982 phoenixs_flames Fluffy_Pillow 954789.0/1100000: 87% mana combustion, heating_up, pyretic_incantation(5)
4:20.354 pyroblast Fluffy_Pillow 977427.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5)
4:21.727 phoenixs_flames Fluffy_Pillow 972581.5/1100000: 88% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
4:23.099 pyroblast Fluffy_Pillow 995219.5/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
4:24.474 counterspell Fluffy_Pillow 990407.0/1100000: 90% mana
4:24.474 living_bomb Fluffy_Pillow 968407.0/1100000: 88% mana
4:25.848 fireball Fluffy_Pillow 974578.0/1100000: 89% mana
4:27.659 fireball Fluffy_Pillow 982459.5/1100000: 89% mana
4:29.030 Waiting 0.200 sec 1005081.0/1100000: 91% mana raid_movement, heating_up, pyretic_incantation
4:29.230 fireball Fluffy_Pillow 1008381.0/1100000: 92% mana heating_up, pyretic_incantation
4:31.040 fireball Fluffy_Pillow 1016246.0/1100000: 92% mana heating_up, pyretic_incantation
4:32.852 fireball Fluffy_Pillow 1024144.0/1100000: 93% mana enhanced_pyrotechnics
4:34.661 fire_blast Fluffy_Pillow 1031992.5/1100000: 94% mana heating_up, pyretic_incantation
4:34.661 pyroblast Fluffy_Pillow 1020992.5/1100000: 93% mana hot_streak, pyretic_incantation(2)
4:36.032 fireball Fluffy_Pillow 1016114.0/1100000: 92% mana heating_up
4:37.842 fireball Fluffy_Pillow 1023979.0/1100000: 93% mana heating_up
4:39.653 living_bomb Fluffy_Pillow 1031860.5/1100000: 94% mana enhanced_pyrotechnics
4:41.025 fireball Fluffy_Pillow 1037998.5/1100000: 94% mana heating_up, pyretic_incantation
4:42.834 fireball Fluffy_Pillow 1045847.0/1100000: 95% mana heating_up, pyretic_incantation
4:44.207 Waiting 1.000 sec 1068501.5/1100000: 97% mana raid_movement, enhanced_pyrotechnics
4:45.207 rune_of_power Fluffy_Pillow 1085001.5/1100000: 99% mana enhanced_pyrotechnics
4:46.580 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, rune_of_power
4:46.580 phoenixs_flames Fluffy_Pillow 1089000.0/1100000: 99% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
4:47.955 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
4:49.329 fire_blast Fluffy_Pillow 1095171.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
4:49.329 pyroblast Fluffy_Pillow 1084171.0/1100000: 99% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
4:50.702 living_bomb Fluffy_Pillow 1079325.5/1100000: 98% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), rune_of_power
4:52.079 Waiting 1.500 sec 1085546.0/1100000: 99% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:53.579 fireball Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:55.390 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
4:57.201 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics(2)
4:59.008 fireball Fluffy_Pillow 1078016.5/1100000: 98% mana heating_up, pyretic_incantation
5:00.379 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(2)
5:01.754 counterspell Fluffy_Pillow 1095187.5/1100000: 100% mana heating_up, pyretic_incantation(3)
5:01.754 fireball Fluffy_Pillow 1073187.5/1100000: 98% mana heating_up, pyretic_incantation(3)
5:03.565 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation(3)
5:05.374 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:06.747 living_bomb Fluffy_Pillow 1073204.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:08.119 fire_blast Fluffy_Pillow 1079342.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:08.119 pyroblast Fluffy_Pillow 1068342.0/1100000: 97% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:09.492 fireball Fluffy_Pillow 1063496.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
5:11.302 fire_blast Fluffy_Pillow 1071361.5/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
5:11.302 pyroblast Fluffy_Pillow 1060361.5/1100000: 96% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4)
5:12.674 fireball Fluffy_Pillow 1055499.5/1100000: 96% mana hot_streak, pyretic_incantation(5)
5:14.486 pyroblast Fluffy_Pillow 1063397.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
5:15.859 fireball Fluffy_Pillow 1058552.0/1100000: 96% mana enhanced_pyrotechnics
5:17.233 fireball Fluffy_Pillow 1081223.0/1100000: 98% mana enhanced_pyrotechnics
5:19.044 fireball Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics
5:20.856 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, pyretic_incantation
5:22.668 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana enhanced_pyrotechnics
5:24.477 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
5:26.287 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
5:27.661 fireball Fluffy_Pillow 1073237.0/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:29.472 pyroblast Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(4)
5:30.845 fireball Fluffy_Pillow 1073237.0/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:32.219 pyroblast Fluffy_Pillow 1095908.0/1100000: 100% mana raid_movement, hot_streak, pyretic_incantation(5)
5:33.592 fireball Fluffy_Pillow 1091062.5/1100000: 99% mana heating_up, pyretic_incantation(5)
5:35.402 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation(5)
5:36.775 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(5), rune_of_power
5:36.775 pyroblast Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:38.148 counterspell Fluffy_Pillow 985154.5/1100000: 90% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:38.148 fire_blast Fluffy_Pillow 963154.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:38.148 pyroblast Fluffy_Pillow 952154.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:39.524 fire_blast Fluffy_Pillow 947358.5/1100000: 86% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:39.524 flame_on Fluffy_Pillow 936358.5/1100000: 85% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:39.524 pyroblast Fluffy_Pillow 936358.5/1100000: 85% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:40.897 fire_blast Fluffy_Pillow 931513.0/1100000: 85% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:40.897 pyroblast Fluffy_Pillow 920513.0/1100000: 84% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:42.271 arcane_torrent Fluffy_Pillow 915684.0/1100000: 83% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:42.271 fire_blast Fluffy_Pillow 948684.0/1100000: 86% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:42.271 pyroblast Fluffy_Pillow 937684.0/1100000: 85% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:43.646 phoenixs_flames Fluffy_Pillow 932871.5/1100000: 85% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:45.020 pyroblast Fluffy_Pillow 955542.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
5:46.395 phoenixs_flames Fluffy_Pillow 950730.0/1100000: 86% mana combustion, heating_up, pyretic_incantation(5), rune_of_power
5:47.768 pyroblast Fluffy_Pillow 973384.5/1100000: 88% mana hot_streak, pyretic_incantation(5)
5:49.140 Waiting 0.100 sec 968522.5/1100000: 88% mana raid_movement, heating_up, pyretic_incantation(5)
5:49.240 fireball Fluffy_Pillow 970172.5/1100000: 88% mana heating_up, pyretic_incantation(5)
5:51.052 fireball Fluffy_Pillow 978070.5/1100000: 89% mana heating_up, pyretic_incantation(5)
5:52.862 pyroblast Fluffy_Pillow 985935.5/1100000: 90% mana hot_streak, pyretic_incantation(5)
5:54.235 fireball Fluffy_Pillow 981090.0/1100000: 89% mana hot_streak, pyretic_incantation(5)
5:56.045 pyroblast Fluffy_Pillow 988955.0/1100000: 90% mana hot_streak, pyretic_incantation(5)
5:57.418 fire_blast Fluffy_Pillow 984109.5/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:57.418 fireball Fluffy_Pillow 973109.5/1100000: 88% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:59.228 pyroblast Fluffy_Pillow 980974.5/1100000: 89% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
6:00.601 fireball Fluffy_Pillow 976129.0/1100000: 89% mana heating_up
6:02.411 fireball Fluffy_Pillow 983994.0/1100000: 89% mana heating_up
6:04.005 Waiting 1.200 sec 1010295.0/1100000: 92% mana raid_movement, enhanced_pyrotechnics
6:05.205 fireball Fluffy_Pillow 1030095.0/1100000: 94% mana enhanced_pyrotechnics
6:07.015 fireball Fluffy_Pillow 1037960.0/1100000: 94% mana enhanced_pyrotechnics
6:08.826 rune_of_power Fluffy_Pillow 1045841.5/1100000: 95% mana heating_up, pyretic_incantation
6:10.200 pyroblast Fluffy_Pillow 1068512.5/1100000: 97% mana hot_streak, pyretic_incantation(2), rune_of_power
6:11.574 fire_blast Fluffy_Pillow 1063683.5/1100000: 97% mana heating_up, pyretic_incantation(3), rune_of_power
6:11.574 pyroblast Fluffy_Pillow 1052683.5/1100000: 96% mana hot_streak, pyretic_incantation(4), rune_of_power
6:12.949 phoenixs_flames Fluffy_Pillow 1047871.0/1100000: 95% mana heating_up, pyretic_incantation(5), rune_of_power
6:14.322 pyroblast Fluffy_Pillow 1070525.5/1100000: 97% mana hot_streak, pyretic_incantation(5), rune_of_power
6:15.694 counterspell Fluffy_Pillow 1065663.5/1100000: 97% mana rune_of_power
6:15.694 fire_blast Fluffy_Pillow 1043663.5/1100000: 95% mana rune_of_power
6:15.694 phoenixs_flames Fluffy_Pillow 1032663.5/1100000: 94% mana heating_up, pyretic_incantation, rune_of_power
6:17.068 pyroblast Fluffy_Pillow 1055334.5/1100000: 96% mana hot_streak, pyretic_incantation(2), rune_of_power
6:18.443 phoenixs_flames Fluffy_Pillow 1050522.0/1100000: 96% mana rune_of_power
6:19.816 fireball Fluffy_Pillow 1073176.5/1100000: 98% mana heating_up, pyretic_incantation, rune_of_power
6:21.189 fireball Fluffy_Pillow 1095831.0/1100000: 100% mana heating_up, pyretic_incantation
6:22.998 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation
6:24.808 rune_of_power Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
6:26.182 pyroblast Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(3), rune_of_power
6:27.555 fire_blast Fluffy_Pillow 1095154.5/1100000: 100% mana heating_up, pyretic_incantation(4), rune_of_power
6:27.555 pyroblast Fluffy_Pillow 1084154.5/1100000: 99% mana hot_streak, pyretic_incantation(5), rune_of_power
6:28.929 flame_on Fluffy_Pillow 1079325.5/1100000: 98% mana rune_of_power
6:28.929 fire_blast Fluffy_Pillow 1079325.5/1100000: 98% mana rune_of_power
6:28.929 fireball Fluffy_Pillow 1068325.5/1100000: 97% mana heating_up, pyretic_incantation, rune_of_power
6:30.740 fire_blast Fluffy_Pillow 1076207.0/1100000: 98% mana heating_up, pyretic_incantation, rune_of_power
6:30.740 pyroblast Fluffy_Pillow 1065207.0/1100000: 97% mana hot_streak, pyretic_incantation(2), rune_of_power
6:32.114 fireball Fluffy_Pillow 1060378.0/1100000: 96% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:33.924 fireball Fluffy_Pillow 1068243.0/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 31572 31572 19673
Intellect 31999 30293 21520 (1929)
Spirit 2 2 0
Health 1894320 1894320 0
Mana 1100000 1100000 0
Spell Power 31999 30293 0
Crit 44.48% 43.41% 13092
Haste 9.57% 9.57% 3109
Damage / Heal Versatility 2.38% 2.38% 952
ManaReg per Second 16500 16500 0
Mastery 9.20% 9.20% 1496
Armor 1607 1607 1607
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 855.00
Local Head Mana-Etched Crown
ilevel: 835, stats: { 200 Armor, +1692 Sta, +1128 Int, +1237 Crit }
Local Neck Blackened Portalstone Necklace
ilevel: 850, stats: { +1094 Sta, +1206 Crit, +629 Haste }, gems: { +150 Crit }, enchant: mark_of_the_hidden_satyr
Local Shoulders Shoulderpads of Chaotic Thought
ilevel: 860, stats: { 202 Armor, +1068 Int, +1601 Sta, +682 Crit, +334 Vers }
Local Chest Terrorweave Robe
ilevel: 850, stats: { 260 Armor, +1297 Int, +1945 Sta, +876 Crit, +428 Haste }
Local Waist Netherwhisper Cinch
ilevel: 840, stats: { 141 Armor, +886 Int, +1329 Sta, +674 Crit, +269 Vers }
Local Legs Bonespeaker Leggings
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +915 Crit, +366 Mastery }, gems: { +150 Crit }
Local Feet Wilderness Stalker's Softsoles
ilevel: 855, stats: { 182 Armor, +1019 Int, +1529 Sta, +648 Crit, +349 Vers }
Local Wrists Bracers of Tirisgarde
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +490 Crit, +217 Mastery }, gems: { +150 Crit }
Local Hands Bonespeaker Gloves
ilevel: 845, stats: { 160 Armor, +929 Int, +1393 Sta, +645 Crit, +315 Mastery }
Local Finger1 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Finger2 Nightmare Loop
ilevel: 835, stats: { +952 Sta, +1191 Crit, +546 Haste }, gems: { +150 Crit }, enchant: { +200 Crit }
Local Trinket1 Twisting Wind
ilevel: 850, stats: { +1233 AgiInt }
Local Trinket2 Unstable Horrorslime
ilevel: 865, stats: { +986 Crit }
Local Back Stormsky Greatcloak
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +437 Crit, +283 Mastery }, gems: { +150 Crit }, enchant: { +200 Int }
Local Main Hand Felo'melorn
ilevel: 881, weapon: { 2199 - 4085, 2.6 }, stats: { +742 Int, +1113 Sta, +315 Haste, +315 Mastery, +9445 Int }, relics: { +46 ilevels, +43 ilevels, +42 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 881, stats: { +974 Int, +1461 Sta, +571 Haste, +253 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Mellarene"
origin="https://us.api.battle.net/wow/character/thrall/Mellarene/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/197/156956101-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=alchemy=408/herbalism=795
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:751:3:752:3:754:3:755:3:756:3:759:1:761:1:762:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=manaetched_crown,id=127450,bonus_id=615/656
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1808/1472,gems=150crit,enchant=mark_of_the_hidden_satyr
shoulders=shoulderpads_of_chaotic_thought,id=142152,bonus_id=3453/1472
back=stormsky_greatcloak,id=134202,bonus_id=3474/1808/1507/1674,gems=150crit,enchant=200int
chest=terrorweave_robe,id=121327,bonus_id=3473/1512/3336
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3386/3384,gems=150crit
hands=bonespeaker_gloves,id=134217,bonus_id=3474/1507/1674
waist=netherwhisper_cinch,id=134391,bonus_id=1727/1502/1813
legs=bonespeaker_leggings,id=134218,bonus_id=1727/1808/1507/3336,gems=150crit
feet=wilderness_stalkers_softsoles,id=142148,bonus_id=3452/1472
finger1=sephuzs_secret,id=132452,bonus_id=1811/3458,gems=150crit,enchant=200crit
finger2=nightmare_loop,id=121288,bonus_id=3397/1808/1497/3336,gems=150crit,enchant=200crit
trinket1=twisting_wind,id=139323,bonus_id=1807/1472
trinket2=unstable_horrorslime,id=138224,bonus_id=1805/1487
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=139256/141259/141261/0,relic_id=1807:1482:3336/3474:1512:3336/3473:1507:3336/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=854.50
# gear_stamina=19673
# gear_intellect=21520
# gear_crit_rating=13092
# gear_haste_rating=3109
# gear_mastery_rating=1496
# gear_versatility_rating=952
# gear_armor=1607

Morepyro

Morepyro : 271271 dps, 194847 dps to main target

  • Race: Blood Elf
  • Class: Mage
  • Spec: Fire
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
271271.3 271271.3 285.2 / 0.105% 55362.5 / 20.4% 16.7
RPS Out RPS In Primary Resource Waiting APM Active Skill
16120.1 16120.1 Mana 3.75% 49.4 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Morepyro/advanced
Talents
  • 15: Conflagration (Fire Mage)
  • 30: Shimmer
  • 45: Rune of Power
  • 60: Flame On (Fire Mage)
  • 75: Ice Floes
  • 90: Living Bomb (Fire Mage)
  • 100: Kindling (Fire Mage)
  • Talent Calculator
Artifact
Professions
  • tailoring: 727
  • enchanting: 727
Scale Factors for Morepyro Damage Per Second
Int Vers Haste Crit Mastery
Scale Factors 8.84 6.74 5.31 5.14 3.97
Normalized 1.00 0.76 0.60 0.58 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.36 0.36 0.36 0.35 0.36
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste ~= Crit > Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=8.84, CritRating=5.14, HasteRating=5.31, MasteryRating=3.97, Versatility=6.74 )

Scale Factors for other metrics

Scale Factors for Morepyro Damage Per Second
Int Vers Haste Crit Mastery
Scale Factors 8.84 6.74 5.31 5.14 3.97
Normalized 1.00 0.76 0.60 0.58 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.36 0.36 0.36 0.35 0.36
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste ~= Crit > Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=8.84, CritRating=5.14, HasteRating=5.31, MasteryRating=3.97, Versatility=6.74 )
Scale Factors for Morepyro Priority Target Damage Per Second
Crit Int Vers Haste Mastery
Scale Factors 6.44 6.20 4.76 4.61 3.92
Normalized 1.04 1.00 0.77 0.74 0.63
Scale Deltas 1138 1138 1138 1138 1138
Error 0.18 0.18 0.18 0.19 0.18
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Vers ~= Haste > Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=6.20, CritRating=6.44, HasteRating=4.61, MasteryRating=3.92, Versatility=4.76 )
Scale Factors for Morepyro Damage Per Second (Effective)
Int Vers Haste Crit Mastery
Scale Factors 8.84 6.74 5.31 5.14 3.97
Normalized 1.00 0.76 0.60 0.58 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Vers > Haste > Crit > Mastery
Pawn string ( Pawn: v1: "Morepyro": Intellect=8.84, CritRating=5.14, HasteRating=5.31, MasteryRating=3.97, Versatility=6.74 )
Scale Factors for Morepyro Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for Morepyro Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )
Scale Factors for MorepyroTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Morepyro": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Morepyro 271271
Conflagration (_dot) 754 0.3% 106.4 3.61sec 2840 0 Periodic 182.9 1652 0 1652 0.0% 89.9%

Stats details: conflagration_dot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.39 0.00 182.89 182.89 0.0000 1.9688 302159.67 302159.67 0.00 839.18 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 182.9 100.00% 1652.17 1 2378 1651.44 1583 1720 302160 302160 0.00
 
 

Action details: conflagration_dot

Static Values
  • id:226757
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:226757
  • name:Conflagration
  • school:fire
  • tooltip:Deals $w1 Fire damage every $t1 sec.
  • description:{$@spelldesc205023=Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.}
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.050000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Conflagration (_explosion) 15192 5.6% 56.4 6.90sec 106613 0 Direct 238.1 13500 32225 25244 62.7%  

Stats details: conflagration_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.38 238.11 0.00 0.00 0.0000 0.0000 6010795.56 6010795.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 88.77 37.28% 13500.05 12682 19022 13476.07 12682 16255 1198388 1198388 0.00
crit 149.34 62.72% 32225.10 25363 47556 32117.80 27251 39219 4812407 4812407 0.00
 
 

Action details: conflagration_explosion

Static Values
  • id:205023
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205023
  • name:Conflagration
  • school:fire
  • tooltip:
  • description:Fireball also applies Conflagration to the target, dealing an additional $226757o1 Fire damage over {$226757d=8 seconds}. Enemies affected by either Conflagration or Ignite have a {$s1=10}% chance to flare up and deal {$205345s1=1} Fire damage to nearby enemies.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.400000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Deadly Grace 10519 3.8% 21.1 5.43sec 196384 0 Direct 21.1 83653 234773 197032 75.0%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.14 21.07 0.00 0.00 0.0000 0.0000 4151491.17 4151491.17 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.26 24.97% 83653.23 79173 118760 83494.53 0 118760 440171 440171 0.00
crit 15.81 75.03% 234772.75 158346 296899 235135.72 191747 280624 3711320 3711320 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Fire Blast 14033 5.2% 45.7 8.83sec 123048 0 Direct 45.7 0 123049 123049 100.0%  

Stats details: fire_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.66 45.66 0.00 0.00 0.0000 0.0000 5618169.59 5618169.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 45.66 100.00% 123048.62 88764 166432 122969.16 110261 135974 5618170 5618170 0.00
 
 

Action details: fire_blast

Static Values
  • id:108853
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.heating_up.up
Spelldata
  • id:108853
  • name:Fire Blast
  • school:fire
  • tooltip:
  • description:Blasts the enemy for {$s1=0} Fire damage. Castable while casting other spells.$?a231568[ Always deals a critical strike.][]$?a231567[ Maximum ${{$231567s1=1}+1} charges.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.400000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Fireball 28439 10.6% 106.6 3.62sec 107097 58491 Direct 106.4 61638 132191 107302 64.7%  

Stats details: fireball

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 106.59 106.39 0.00 0.00 1.8310 0.0000 11415564.57 11415564.57 0.00 58490.96 58490.96
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.53 35.28% 61638.38 60471 90707 61635.22 60471 67299 2313309 2313309 0.00
crit 68.86 64.72% 132190.96 120943 226768 132165.44 125781 142108 9102256 9102256 0.00
 
 

Action details: fireball

Static Values
  • id:133
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:28.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.25
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:133
  • name:Fireball
  • school:fire
  • tooltip:
  • description:Throws a fiery ball that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.750000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Mastery: Ignite (ignite) 49095 18.2% 277.2 1.47sec 70961 0 Periodic 562.8 34946 0 34946 0.0% 140.5%

Stats details: ignite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 277.18 0.00 562.84 562.84 0.0000 1.0000 19668727.17 19668727.17 0.00 34945.38 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 562.8 100.00% 34945.81 1151 220077 35123.21 24310 50846 19668727 19668727 0.00
 
 

Action details: ignite

Static Values
  • id:12846
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:12846
  • name:Mastery: Ignite
  • school:physical
  • tooltip:
  • description:Your target burns for an additional $m1% over {$12654d=9 seconds} of the total direct damage caused by your Fireball, Fire Blast, Scorch, Pyroblast{$?s153561=false}[, Meteor][]{$?s198929=false}[, Cinderstorm][], and Flamestrike. If this effect is reapplied, any remaining damage will be added to the new Ignite. Every $t3 sec, your Ignites may spread to another nearby enemy.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:9.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Living Bomb 11046 4.0% 96.6 8.63sec 45140 175853 Periodic 308.8 8070 18452 14118 58.3% 66.9%

Stats details: living_bomb

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.58 0.00 308.79 308.79 0.2567 0.8681 4359582.04 4359582.04 0.00 14887.45 175853.42
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.9 41.74% 8069.66 7926 11890 8070.39 7926 8811 1040043 1040043 0.00
crit 179.9 58.26% 18451.63 15853 29724 18432.05 16554 20994 3319539 3319539 0.00
 
 

Action details: living_bomb

Static Values
  • id:44457
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:16500.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>1&buff.combustion.down
Spelldata
  • id:44457
  • name:Living Bomb
  • school:fire
  • tooltip:Causes $w1 Fire damage every $t1 sec. After {$d=0 milliseconds}, the target explodes, causing $w2 Fire damage to the target and all other enemies within $44461A2 yards$?$w3>0[, and spreading Living Bomb][].
  • description:The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.250000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Living Bomb (_explosion) 60030 21.9% 96.6 8.50sec 245342 0 Direct 517.7 25872 59937 45771 58.4%  

Stats details: living_bomb_explosion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 96.58 517.68 0.00 0.00 0.0000 0.0000 23694708.03 23694708.03 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 215.27 41.58% 25871.64 25362 38043 25875.69 25362 28338 5569385 5569385 0.00
crit 302.41 58.42% 59936.73 50724 95108 59845.68 52148 68752 18125323 18125323 0.00
 
 

Action details: living_bomb_explosion

Static Values
  • id:44461
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:44461
  • name:Living Bomb
  • school:fire
  • tooltip:
  • description:{$@spelldesc44457=The target becomes a Living Bomb, taking $217694o1 Fire damage over {$217694d=4 seconds}, and then exploding to deal an additional {$44461s2=1} Fire damage to the target and all other enemies within $44461A2 yards. Other enemies hit by this explosion also become a Living Bomb, but this effect cannot spread further.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.800000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phoenix's Flames 8554 3.2% 11.3 37.39sec 302280 237691 Direct 11.3 0 302735 302735 100.0%  

Stats details: phoenixs_flames

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.30 11.28 0.00 0.00 1.2717 0.0000 3415616.69 3415616.69 0.00 237690.79 237690.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 11.28 100.00% 302735.29 190210 356644 302717.95 253613 354266 3415617 3415617 0.00
 
 

Action details: phoenixs_flames

Static Values
  • id:194466
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:50.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194466
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Phoenix's Flames (_splash) 5276 1.9% 11.3 37.41sec 184563 0 Direct 22.3 0 93466 93466 100.0%  

Stats details: phoenixs_flames_splash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.28 22.28 0.00 0.00 0.0000 0.0000 2082333.22 2082333.22 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 22.28 100.00% 93466.42 66573 118880 93694.75 72913 118880 2082333 2082333 0.00
 
 

Action details: phoenixs_flames_splash

Static Values
  • id:224637
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224637
  • name:Phoenix's Flames
  • school:fire
  • tooltip:
  • description:{$@spelldesc194466=Hurls a Phoenix that causes {$s1=1} Fire damage to the target and splashes {$224637s2=0} Fire damage to other nearby enemies. This damage is always a critical strike.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Pyroblast 68160 25.3% 89.3 4.49sec 305828 233538 Direct 90.1 137293 363300 303019 73.3%  

Stats details: pyroblast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.28 90.11 0.00 0.00 1.3095 0.0000 27305304.49 27305304.49 0.00 233538.36 233538.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.04 26.67% 137293.28 128734 193101 137225.09 128734 153490 3299922 3299922 0.00
crit 66.08 73.33% 363299.70 257468 482752 363447.58 327142 406738 24005383 24005383 0.00
 
 

Action details: pyroblast

Static Values
  • id:11366
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:24.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:27500.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:4.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:11366
  • name:Pyroblast
  • school:fire
  • tooltip:
  • description:Hurls an immense fiery boulder that causes {$s1=1} Fire damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.760000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Scorch 173 0.1% 1.5 129.95sec 45739 31730 Direct 1.5 0 45743 45743 100.0%  

Stats details: scorch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.52 1.52 0.00 0.00 1.4420 0.0000 69457.44 69457.44 0.00 31730.22 31730.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
crit 1.52 100.00% 45742.57 31703 59444 38250.50 0 59444 69457 69457 0.00
 
 

Action details: scorch

Static Values
  • id:2948
  • school:fire
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:11000.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.combustion.remains>cast_time
Spelldata
  • id:2948
  • name:Scorch
  • school:fire
  • tooltip:
  • description:Scorches an enemy for {$s1=1} Fire damage. Castable while moving.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Simple Action Stats Execute Interval
Morepyro
Arcane Torrent 3.9 114.94sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.91 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:28730
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:28730
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and restore {$s2=3}% of your Mana. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
Combustion 5.3 84.34sec

Stats details: combustion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.26 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: combustion

Static Values
  • id:190319
  • school:fire
  • resource:mana
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:110000.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:190319
  • name:Combustion
  • school:fire
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
 
Counterspell 10.0 41.36sec

Stats details: counterspell

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.01 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: counterspell

Static Values
  • id:2139
  • school:arcane
  • resource:mana
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:22000.0
  • secondary_cost:0.0
  • cooldown:24.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:target.debuff.casting.react
Spelldata
  • id:2139
  • name:Counterspell
  • school:arcane
  • tooltip:
  • description:Counters the enemy's spellcast, preventing any spell from that school of magic from being cast for {$d=6 seconds}$?s12598[ and silencing the target for $55021d][].
 
Flame On 5.7 80.96sec

Stats details: flame_on

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.65 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flame_on

Static Values
  • id:205029
  • school:fire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
Spelldata
  • id:205029
  • name:Flame On
  • school:fire
  • tooltip:
  • description:Immediately grants {$s1=2} charges of Fire Blast.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Morepyro
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rune of Power 8.7 50.26sec

Stats details: rune_of_power

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.74 0.00 0.00 0.00 1.5197 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rune_of_power

Static Values
  • id:116011
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
Spelldata
  • id:116011
  • name:Rune of Power
  • school:arcane
  • tooltip:
  • description:Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 17.92% 0.0(0.0) 1.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Combustion 5.3 0.0 84.3sec 84.3sec 12.98% 78.05% 103.9(103.9) 5.1

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_combustion
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • combustion_1:12.98%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190319
  • name:Combustion
  • tooltip:Critical Strike chance increased by $w1%.$?a231630[ Mastery increased by $w2.][]
  • description:Engulfs you in flames for {$d=10 seconds}, increasing your critical strike chance by {$s1=100}% and granting you Mastery equal to your Critical Strike stat. Castable while casting other spells.
  • max_stacks:0
  • duration:10.00
  • cooldown:120.00
  • default_chance:0.00%
Enhanced Pyrotechnics 28.0 9.5 13.6sec 10.1sec 32.76% 34.41% 0.0(0.0) 0.7

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_enhanced_pyrotechnics
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • enhanced_pyrotechnics_1:26.06%
  • enhanced_pyrotechnics_2:5.64%
  • enhanced_pyrotechnics_3:1.00%
  • enhanced_pyrotechnics_4:0.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:157644
  • name:Enhanced Pyrotechnics
  • tooltip:Increases critical strike chance of Fireball by {$s1=10}%.
  • description:{$@spelldesc157642=Each time your Fireball fails to critically strike a target, it gains a stacking {$157644s1=10}% increased critical strike chance. Effect ends when Fireball critically strikes.}
  • max_stacks:10
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Heating Up 103.1 0.0 3.9sec 3.9sec 41.80% 46.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_heating_up
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • heating_up_1:41.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48107
  • name:Heating Up
  • tooltip:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • description:Scored a spell critical. A second spell critical in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.
  • max_stacks:2
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Hot Streak! 89.4 0.0 4.5sec 4.5sec 16.32% 98.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_hot_streak
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hot_streak_1:16.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:48108
  • name:Hot Streak!
  • tooltip:Your next Pyroblast or Flamestrike spell is instant cast, and causes double the normal Ignite damage.
  • description:{$@spelldesc195283=Getting two direct-damage critical strikes in a row will make your next Pyroblast or Flamestrike spell instant cast, and cause double the normal Ignite damage.}
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of Deadly Grace 2.0 0.0 83.0sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Pyretic Incantation 45.4 148.0 8.8sec 2.1sec 68.05% 100.00% 61.8(61.8) 1.1

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_pyretic_incantation
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • pyretic_incantation_1:20.27%
  • pyretic_incantation_2:10.38%
  • pyretic_incantation_3:5.69%
  • pyretic_incantation_4:7.29%
  • pyretic_incantation_5:24.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194329
  • name:Pyretic Incantation
  • tooltip:Your spells deal an additional $m1% critical hit damage.
  • description:Your spells deal an additional $m1% critical hit damage.
  • max_stacks:5
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.51% 14.51% 2.0(2.0) 0.0

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.51%

Trigger Attempt Success

  • trigger_pct:100.00%
Rune of Power 8.7 0.0 50.3sec 50.3sec 14.16% 14.16% 0.0(0.0) 2.4

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_rune_of_power
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • rune_of_power_1:14.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:116014
  • name:Rune of Power
  • tooltip:Spell damage increased by $w1%.$?$w2=0[][ Health restored by $w2% per second.]
  • description:{$@spelldesc116011=Places a Rune of Power on the ground for {$116011d=10 seconds} which increases your spell damage by {$116014s1=50}% while you stand within 8 yds. Max 2 charges.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Voidsight 6.4 1.9 58.9sec 44.0sec 27.15% 27.15% 1.9(1.9) 6.2

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_voidsight
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:1102.73
  • stat:haste_rating
  • amount:1102.73
  • stat:mastery_rating
  • amount:1102.73

Stack Uptimes

  • voidsight_1:27.15%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:201410
  • name:Voidsight
  • tooltip:Critical Strike, Haste and Mastery increased by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • description:Increases Critical Strike, Haste and Mastery by {$s1=1145}. Damage against Demons increased by {$s2=10}%.
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Molten Armor

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_molten_armor
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • molten_armor_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:30482
  • name:Molten Armor
  • tooltip:Spell critical strike chance increased by $w1%. Physical damage taken reduced by $w2%.
  • description:Increases your spell critical strike chance by {$s1=10}% and reduces all Physical damage you take by {$s2=6}%.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:0.00%
Well Fed (the_hungry_magister)

Buff details

  • buff initial source:Morepyro
  • cooldown name:buff_the_hungry_magister
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:375.00

Stack Uptimes

  • the_hungry_magister_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225602
  • name:Well Fed
  • tooltip:Critical Strike increased by $w1.
  • description:Increases critical strike by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Morepyro
combustion Mana 5.3 579119.3 110000.0 109997.8 0.0
counterspell Mana 10.0 220127.6 22000.0 22000.0 0.0
fire_blast Mana 45.7 502250.1 11000.0 11000.2 11.2
fireball Mana 106.6 2344973.9 22000.0 21999.8 4.9
living_bomb Mana 18.8 309580.8 16500.0 3205.5 14.1
pyroblast Mana 90.3 2482821.4 27500.0 27808.3 11.0
scorch Mana 1.5 16706.2 11000.0 11001.4 4.2
Resource Gains Type Count Total Average Overflow
arcane_torrent Mana 3.91 126722.01 (1.99%) 32447.66 2157.12 1.67%
mp5_regen Mana 750.45 6251998.49 (98.01%) 8330.97 350134.54 5.30%
Resource RPS-Gain RPS-Loss
Mana 15928.13 16120.10
Combat End Resource Mean Min Max
Mana 1022652.71 892941.50 1100000.00

Benefits & Uptimes

Benefits %
Uptimes %
Mana Cap 1.8%

Procs

Count Interval
Heating Up generated 103.1 3.9sec
Heating Up removed 13.1 27.5sec
IB conversions of HU 43.6 9.2sec
Total Hot Streak procs 89.4 4.5sec
Hot Streak spells used 255.0 1.6sec
Hot Streak spell crits 193.4 2.1sec
Wasted Hot Streak spell crits 0.9 117.9sec
Direct Ignite applications 20.0 64.5sec
Ignites spread 1.0 0.0sec

Statistics & Data Analysis

Fight Length
Sample Data Morepyro Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Morepyro Damage Per Second
Count 9999
Mean 271271.35
Minimum 231532.69
Maximum 322971.00
Spread ( max - min ) 91438.31
Range [ ( max - min ) / 2 * 100% ] 16.85%
Standard Deviation 14549.2845
5th Percentile 249588.97
95th Percentile 296739.09
( 95th Percentile - 5th Percentile ) 47150.13
Mean Distribution
Standard Deviation 145.5001
95.00% Confidence Intervall ( 270986.17 - 271556.52 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 110
0.1% Error 11050
0.1 Scale Factor Error with Delta=300 1807036
0.05 Scale Factor Error with Delta=300 7228146
0.01 Scale Factor Error with Delta=300 180703656
Priority Target DPS
Sample Data Morepyro Priority Target Damage Per Second
Count 9999
Mean 194846.95
Minimum 172076.16
Maximum 231804.45
Spread ( max - min ) 59728.29
Range [ ( max - min ) / 2 * 100% ] 15.33%
Standard Deviation 7401.9793
5th Percentile 182750.43
95th Percentile 206663.80
( 95th Percentile - 5th Percentile ) 23913.38
Mean Distribution
Standard Deviation 74.0235
95.00% Confidence Intervall ( 194701.87 - 194992.04 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 55
0.1% Error 5543
0.1 Scale Factor Error with Delta=300 467712
0.05 Scale Factor Error with Delta=300 1870851
0.01 Scale Factor Error with Delta=300 46771295
DPS(e)
Sample Data Morepyro Damage Per Second (Effective)
Count 9999
Mean 271271.35
Minimum 231532.69
Maximum 322971.00
Spread ( max - min ) 91438.31
Range [ ( max - min ) / 2 * 100% ] 16.85%
Damage
Sample Data Morepyro Damage
Count 9999
Mean 108093909.65
Minimum 84157957.59
Maximum 132989035.19
Spread ( max - min ) 48831077.61
Range [ ( max - min ) / 2 * 100% ] 22.59%
DTPS
Sample Data Morepyro Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Morepyro Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Morepyro Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Morepyro Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Morepyro Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Morepyro Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data MorepyroTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Morepyro Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=the_hungry_magister
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
4 0.00 mirror_image
5 0.00 potion,name=deadly_grace
6 0.00 pyroblast
Default action list Executed every time the actor is available.
# count action,conditions
7 10.01 counterspell,if=target.debuff.casting.react
0.00 time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
0.00 mirror_image,if=buff.combustion.down
8 6.47 rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
9 0.00 call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
A 0.00 call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
B 0.00 call_action_list,name=single_target
actions.active_talents
# count action,conditions
C 5.65 flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
0.00 blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
0.00 meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
0.00 cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
0.00 dragons_breath,if=equipped.132863
D 18.76 living_bomb,if=active_enemies>1&buff.combustion.down
actions.combustion_phase
# count action,conditions
E 4.33 rune_of_power,if=buff.combustion.down
F 0.00 call_action_list,name=active_talents
G 5.27 combustion
H 1.00 potion,name=deadly_grace
0.00 blood_fury
0.00 berserking
I 3.91 arcane_torrent
J 30.38 pyroblast,if=buff.hot_streak.up
K 20.62 fire_blast,if=buff.heating_up.up
L 8.68 phoenixs_flames
M 1.76 scorch,if=buff.combustion.remains>cast_time
0.00 scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase
# count action,conditions
0.00 rune_of_power
N 8.05 pyroblast,if=buff.hot_streak.up
O 0.00 call_action_list,name=active_talents
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
P 5.37 fire_blast,if=!prev_off_gcd.fire_blast
Q 2.50 phoenixs_flames,if=!prev_gcd.phoenixs_flames
0.00 scorch,if=target.health.pct<=25&equipped.132454
R 6.36 fireball
actions.single_target
# count action,conditions
0.00 pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
S 0.01 phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
0.00 flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
T 50.86 pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
0.00 pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
0.00 pyroblast,if=buff.kaelthas_ultimate_ability.react
U 0.00 call_action_list,name=active_talents
V 0.18 fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
W 19.49 fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
X 0.12 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
0.00 phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
0.00 scorch,if=target.health.pct<=25&equipped.132454
Y 119.98 fireball

Sample Sequence

01256EGILKJKCJ7KJKJLJLJY8PNRRRRNDYYYWTYYTDTWYTYTY7YTYYWTDYYWTYTWYTDYYTYYTYT7YDGHKJKCJ8KJKJLJYQTDYYYYYYWTYDY7YY8NPNPNDYYTYTYYWTYTDYYWTYTY7YYDYYTYYEGIJKJKCJKJKJLJYDTYYTYWT7YYTYYTYTD8YYWTYTYTDWTYWTYYY7YTDTYYYYYTYDEGLKJKCJKJKJLJYYTDYYYWTYYTYDTY8PNQNYYYDWTYYYT7YTYTDWTYYWTYYYTYYTYYEGIJKJKCJKJKJ7LJYYTYYTYYYWTYYTYT8NPNPNQ7RRNYYTYWT8CPNPNRRRR

Sample Sequence Table

time name target resources buffs
Pre flask Morepyro 1100000.0/1100000: 100% mana
Pre food Morepyro 1100000.0/1100000: 100% mana
Pre augmentation Morepyro 1100000.0/1100000: 100% mana
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana potion_of_deadly_grace
0:00.000 pyroblast Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:00.000 rune_of_power Fluffy_Pillow 1072500.0/1100000: 98% mana potion_of_deadly_grace
0:01.367 combustion Fluffy_Pillow 1095055.5/1100000: 100% mana bloodlust, rune_of_power, potion_of_deadly_grace
0:01.367 arcane_torrent Fluffy_Pillow 985055.5/1100000: 90% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:01.367 phoenixs_flames Fluffy_Pillow 1018055.5/1100000: 93% mana bloodlust, combustion, rune_of_power, potion_of_deadly_grace
0:02.418 fire_blast Fluffy_Pillow 1035397.0/1100000: 94% mana bloodlust, combustion, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:02.418 pyroblast Fluffy_Pillow 1024397.0/1100000: 93% mana bloodlust, combustion, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:03.469 fire_blast Fluffy_Pillow 1014238.5/1100000: 92% mana bloodlust, combustion, heating_up, pyretic_incantation(3), rune_of_power, potion_of_deadly_grace
0:03.469 flame_on Fluffy_Pillow 1003238.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:03.469 pyroblast Fluffy_Pillow 1003238.5/1100000: 91% mana bloodlust, combustion, hot_streak, pyretic_incantation(4), rune_of_power, potion_of_deadly_grace
0:04.522 counterspell Fluffy_Pillow 993113.0/1100000: 90% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.522 fire_blast Fluffy_Pillow 971113.0/1100000: 88% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:04.522 pyroblast Fluffy_Pillow 960113.0/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.573 fire_blast Fluffy_Pillow 949954.5/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:05.573 pyroblast Fluffy_Pillow 938954.5/1100000: 85% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:06.624 phoenixs_flames Fluffy_Pillow 928796.0/1100000: 84% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:07.676 pyroblast Fluffy_Pillow 946154.0/1100000: 86% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:08.728 phoenixs_flames Fluffy_Pillow 936012.0/1100000: 85% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:09.780 pyroblast Fluffy_Pillow 953370.0/1100000: 87% mana bloodlust, combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:10.832 fireball Fluffy_Pillow 943228.0/1100000: 86% mana bloodlust, combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:12.005 Waiting 1.200 sec 962582.5/1100000: 88% mana bloodlust, raid_movement, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:13.205 rune_of_power Fluffy_Pillow 982382.5/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), potion_of_deadly_grace
0:14.257 fire_blast Fluffy_Pillow 999740.5/1100000: 91% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:14.257 pyroblast Fluffy_Pillow 988740.5/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:15.309 fireball Fluffy_Pillow 978598.5/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:16.694 fireball Fluffy_Pillow 979451.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
0:18.080 fireball Fluffy_Pillow 980320.0/1100000: 89% mana bloodlust, enhanced_pyrotechnics, rune_of_power, potion_of_deadly_grace
0:19.467 fireball Fluffy_Pillow 981205.5/1100000: 89% mana bloodlust, heating_up, pyretic_incantation, rune_of_power, potion_of_deadly_grace
0:20.518 pyroblast Fluffy_Pillow 998547.0/1100000: 91% mana bloodlust, raid_movement, hot_streak, pyretic_incantation(2), rune_of_power, potion_of_deadly_grace
0:21.570 living_bomb Fluffy_Pillow 988405.0/1100000: 90% mana bloodlust, raid_movement, potion_of_deadly_grace
0:22.621 Waiting 1.000 sec 989246.5/1100000: 90% mana bloodlust, raid_movement, potion_of_deadly_grace
0:23.621 fireball Fluffy_Pillow 1005746.5/1100000: 91% mana bloodlust
0:25.008 fireball Fluffy_Pillow 1006632.0/1100000: 92% mana bloodlust
0:26.396 fireball Fluffy_Pillow 1007534.0/1100000: 92% mana bloodlust, enhanced_pyrotechnics
0:27.782 fire_blast Fluffy_Pillow 1008403.0/1100000: 92% mana bloodlust, heating_up, pyretic_incantation
0:27.782 pyroblast Fluffy_Pillow 997403.0/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(2)
0:28.835 Waiting 0.400 sec 987277.5/1100000: 90% mana bloodlust, raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:29.235 fireball Fluffy_Pillow 993877.5/1100000: 90% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:30.622 fireball Fluffy_Pillow 994763.0/1100000: 90% mana bloodlust, enhanced_pyrotechnics, heating_up, pyretic_incantation
0:32.008 pyroblast Fluffy_Pillow 995632.0/1100000: 91% mana bloodlust, hot_streak, pyretic_incantation(2)
0:33.056 living_bomb Fluffy_Pillow 985424.0/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(4)
0:34.107 pyroblast Fluffy_Pillow 986265.5/1100000: 90% mana bloodlust, hot_streak, pyretic_incantation(4)
0:35.158 fire_blast Fluffy_Pillow 976107.0/1100000: 89% mana bloodlust, heating_up, pyretic_incantation(5)
0:35.158 fireball Fluffy_Pillow 965107.0/1100000: 88% mana bloodlust, hot_streak, pyretic_incantation(5)
0:36.545 pyroblast Fluffy_Pillow 965992.5/1100000: 88% mana bloodlust, hot_streak, pyretic_incantation(5)
0:37.596 fireball Fluffy_Pillow 955834.0/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(5)
0:38.983 pyroblast Fluffy_Pillow 956719.5/1100000: 87% mana bloodlust, hot_streak, pyretic_incantation(5)
0:40.035 fireball Fluffy_Pillow 946577.5/1100000: 86% mana bloodlust, heating_up
0:41.422 counterspell Fluffy_Pillow 947463.0/1100000: 86% mana heating_up
0:41.422 fireball Fluffy_Pillow 925463.0/1100000: 84% mana heating_up
0:43.224 pyroblast Fluffy_Pillow 933196.0/1100000: 85% mana hot_streak, pyretic_incantation
0:44.591 Waiting 0.600 sec 928251.5/1100000: 84% mana raid_movement, enhanced_pyrotechnics
0:45.191 fireball Fluffy_Pillow 938151.5/1100000: 85% mana enhanced_pyrotechnics
0:46.992 fireball Fluffy_Pillow 945868.0/1100000: 86% mana enhanced_pyrotechnics
0:48.793 fire_blast Fluffy_Pillow 953584.5/1100000: 87% mana heating_up, pyretic_incantation
0:48.793 pyroblast Fluffy_Pillow 942584.5/1100000: 86% mana hot_streak, pyretic_incantation(2)
0:50.160 living_bomb Fluffy_Pillow 937640.0/1100000: 85% mana raid_movement, enhanced_pyrotechnics
0:51.528 Waiting 2.100 sec 943712.0/1100000: 86% mana raid_movement, enhanced_pyrotechnics
0:53.628 fireball Fluffy_Pillow 978362.0/1100000: 89% mana enhanced_pyrotechnics
0:55.431 fireball Fluffy_Pillow 986111.5/1100000: 90% mana enhanced_pyrotechnics, voidsight
0:57.180 fire_blast Fluffy_Pillow 992970.0/1100000: 90% mana heating_up, pyretic_incantation, voidsight
0:57.180 pyroblast Fluffy_Pillow 981970.0/1100000: 89% mana hot_streak, pyretic_incantation(2), voidsight
0:58.506 fireball Fluffy_Pillow 976349.0/1100000: 89% mana hot_streak, pyretic_incantation(4), voidsight
1:00.003 pyroblast Fluffy_Pillow 1001049.5/1100000: 91% mana raid_movement, hot_streak, pyretic_incantation(4), voidsight
1:01.328 fire_blast Fluffy_Pillow 995412.0/1100000: 90% mana heating_up, pyretic_incantation(5), voidsight
1:01.328 fireball Fluffy_Pillow 984412.0/1100000: 89% mana hot_streak, pyretic_incantation(5), voidsight
1:03.076 pyroblast Fluffy_Pillow 991254.0/1100000: 90% mana hot_streak, pyretic_incantation(5), voidsight
1:04.402 living_bomb Fluffy_Pillow 985633.0/1100000: 90% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
1:05.727 fireball Fluffy_Pillow 990995.5/1100000: 90% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
1:07.477 fireball Fluffy_Pillow 997870.5/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
1:09.227 pyroblast Fluffy_Pillow 1004745.5/1100000: 91% mana hot_streak, pyretic_incantation(2)
1:10.594 fireball Fluffy_Pillow 999801.0/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:12.397 fireball Fluffy_Pillow 1007550.5/1100000: 92% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
1:14.200 pyroblast Fluffy_Pillow 1015300.0/1100000: 92% mana hot_streak, pyretic_incantation(2)
1:15.565 fireball Fluffy_Pillow 1010322.5/1100000: 92% mana hot_streak, pyretic_incantation(4)
1:16.930 pyroblast Fluffy_Pillow 1032845.0/1100000: 94% mana raid_movement, hot_streak, pyretic_incantation(4)
1:18.294 counterspell Fluffy_Pillow 1027851.0/1100000: 93% mana heating_up, pyretic_incantation(5)
1:18.294 fireball Fluffy_Pillow 1005851.0/1100000: 91% mana heating_up, pyretic_incantation(5)
1:20.004 living_bomb Fluffy_Pillow 1034066.0/1100000: 94% mana raid_movement, heating_up, pyretic_incantation(5)
1:21.370 combustion Fluffy_Pillow 1040105.0/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(5)
1:21.370 potion Fluffy_Pillow 930105.0/1100000: 85% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
1:21.370 fire_blast Fluffy_Pillow 930105.0/1100000: 85% mana raid_movement, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:21.370 pyroblast Fluffy_Pillow 919105.0/1100000: 84% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:22.736 fire_blast Fluffy_Pillow 914144.0/1100000: 83% mana raid_movement, combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:22.736 flame_on Fluffy_Pillow 903144.0/1100000: 82% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:22.736 pyroblast Fluffy_Pillow 903144.0/1100000: 82% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:24.100 rune_of_power Fluffy_Pillow 898150.0/1100000: 82% mana combustion, heating_up, pyretic_incantation(5), potion_of_deadly_grace
1:25.469 fire_blast Fluffy_Pillow 920738.5/1100000: 84% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:25.469 pyroblast Fluffy_Pillow 909738.5/1100000: 83% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:26.833 fire_blast Fluffy_Pillow 904744.5/1100000: 82% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:26.833 pyroblast Fluffy_Pillow 893744.5/1100000: 81% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:28.200 phoenixs_flames Fluffy_Pillow 888800.0/1100000: 81% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:29.567 pyroblast Fluffy_Pillow 911355.5/1100000: 83% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:30.935 fireball Fluffy_Pillow 906427.5/1100000: 82% mana combustion, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:32.302 phoenixs_flames Fluffy_Pillow 928983.0/1100000: 84% mana raid_movement, heating_up, pyretic_incantation(5), rune_of_power, potion_of_deadly_grace
1:33.668 pyroblast Fluffy_Pillow 951522.0/1100000: 87% mana hot_streak, pyretic_incantation(5), potion_of_deadly_grace
1:35.034 living_bomb Fluffy_Pillow 946561.0/1100000: 86% mana potion_of_deadly_grace
1:36.400 fireball Fluffy_Pillow 952600.0/1100000: 87% mana potion_of_deadly_grace
1:38.202 fireball Fluffy_Pillow 960333.0/1100000: 87% mana potion_of_deadly_grace
1:40.004 fireball Fluffy_Pillow 968066.0/1100000: 88% mana heating_up, pyretic_incantation, potion_of_deadly_grace
1:41.805 fireball Fluffy_Pillow 975782.5/1100000: 89% mana enhanced_pyrotechnics, potion_of_deadly_grace
1:43.606 fireball Fluffy_Pillow 983499.0/1100000: 89% mana enhanced_pyrotechnics(2), potion_of_deadly_grace
1:45.407 fireball Fluffy_Pillow 991215.5/1100000: 90% mana enhanced_pyrotechnics(3), potion_of_deadly_grace
1:47.207 fire_blast Fluffy_Pillow 998915.5/1100000: 91% mana heating_up, pyretic_incantation
1:47.207 pyroblast Fluffy_Pillow 987915.5/1100000: 90% mana hot_streak, pyretic_incantation(2)
1:48.575 Waiting 0.600 sec 982987.5/1100000: 89% mana raid_movement, enhanced_pyrotechnics
1:49.175 fireball Fluffy_Pillow 992887.5/1100000: 90% mana enhanced_pyrotechnics
1:50.542 living_bomb Fluffy_Pillow 1015443.0/1100000: 92% mana raid_movement, enhanced_pyrotechnics
1:51.909 Waiting 1.700 sec 1021498.5/1100000: 93% mana raid_movement, enhanced_pyrotechnics
1:53.609 fireball Fluffy_Pillow 1049548.5/1100000: 95% mana enhanced_pyrotechnics
1:55.410 counterspell Fluffy_Pillow 1057265.0/1100000: 96% mana enhanced_pyrotechnics
1:55.410 fireball Fluffy_Pillow 1035265.0/1100000: 94% mana enhanced_pyrotechnics
1:57.213 fireball Fluffy_Pillow 1043014.5/1100000: 95% mana enhanced_pyrotechnics(2)
1:59.015 rune_of_power Fluffy_Pillow 1050747.5/1100000: 96% mana heating_up, pyretic_incantation
2:00.382 pyroblast Fluffy_Pillow 1073303.0/1100000: 98% mana hot_streak, pyretic_incantation(2), rune_of_power
2:01.749 fire_blast Fluffy_Pillow 1068358.5/1100000: 97% mana heating_up, pyretic_incantation(3), rune_of_power
2:01.749 pyroblast Fluffy_Pillow 1057358.5/1100000: 96% mana hot_streak, pyretic_incantation(4), rune_of_power
2:03.116 fire_blast Fluffy_Pillow 1052414.0/1100000: 96% mana heating_up, pyretic_incantation(5), rune_of_power
2:03.116 pyroblast Fluffy_Pillow 1041414.0/1100000: 95% mana hot_streak, pyretic_incantation(5), rune_of_power
2:04.482 Waiting 0.400 sec 1036453.0/1100000: 94% mana raid_movement, heating_up, pyretic_incantation(5), rune_of_power
2:04.882 living_bomb Fluffy_Pillow 1043053.0/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(5), rune_of_power
2:06.439 fireball Fluffy_Pillow 1052243.5/1100000: 96% mana heating_up, pyretic_incantation(5)
2:08.241 fireball Fluffy_Pillow 1059976.5/1100000: 96% mana heating_up, pyretic_incantation(5)
2:10.041 pyroblast Fluffy_Pillow 1067676.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
2:11.408 fireball Fluffy_Pillow 1062732.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
2:13.210 pyroblast Fluffy_Pillow 1070465.0/1100000: 97% mana hot_streak, pyretic_incantation(5)
2:14.576 fireball Fluffy_Pillow 1065504.0/1100000: 97% mana enhanced_pyrotechnics
2:16.377 fireball Fluffy_Pillow 1073220.5/1100000: 98% mana enhanced_pyrotechnics
2:18.178 fire_blast Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:18.178 pyroblast Fluffy_Pillow 1067066.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:19.545 fireball Fluffy_Pillow 1062121.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:20.913 pyroblast Fluffy_Pillow 1084693.5/1100000: 99% mana hot_streak, pyretic_incantation(4)
2:22.279 living_bomb Fluffy_Pillow 1079732.5/1100000: 98% mana
2:23.646 fireball Fluffy_Pillow 1085788.0/1100000: 99% mana
2:25.446 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana
2:27.248 fire_blast Fluffy_Pillow 1078082.5/1100000: 98% mana heating_up, pyretic_incantation
2:27.248 pyroblast Fluffy_Pillow 1067082.5/1100000: 97% mana hot_streak, pyretic_incantation(2)
2:28.615 fireball Fluffy_Pillow 1062138.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:30.416 pyroblast Fluffy_Pillow 1069854.5/1100000: 97% mana hot_streak, pyretic_incantation(4)
2:31.783 fireball Fluffy_Pillow 1064910.0/1100000: 97% mana enhanced_pyrotechnics
2:33.585 counterspell Fluffy_Pillow 1072643.0/1100000: 98% mana enhanced_pyrotechnics
2:33.585 fireball Fluffy_Pillow 1050643.0/1100000: 96% mana enhanced_pyrotechnics
2:35.387 fireball Fluffy_Pillow 1058376.0/1100000: 96% mana enhanced_pyrotechnics(2)
2:36.755 living_bomb Fluffy_Pillow 1080948.0/1100000: 98% mana raid_movement, heating_up, pyretic_incantation
2:38.177 fireball Fluffy_Pillow 1087911.0/1100000: 99% mana heating_up, pyretic_incantation
2:39.978 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
2:41.779 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
2:43.147 fireball Fluffy_Pillow 1073138.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:44.948 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
2:46.750 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(2)
2:48.116 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana hot_streak, pyretic_incantation(3), rune_of_power
2:48.116 arcane_torrent Fluffy_Pillow 990000.0/1100000: 90% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
2:48.116 pyroblast Fluffy_Pillow 1023000.0/1100000: 93% mana combustion, hot_streak, pyretic_incantation(3), rune_of_power
2:49.481 fire_blast Fluffy_Pillow 1018022.5/1100000: 93% mana combustion, heating_up, pyretic_incantation(4), rune_of_power
2:49.481 pyroblast Fluffy_Pillow 1007022.5/1100000: 92% mana combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:50.848 fire_blast Fluffy_Pillow 1002078.0/1100000: 91% mana raid_movement, combustion, heating_up, pyretic_incantation(5), rune_of_power
2:50.848 flame_on Fluffy_Pillow 991078.0/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:50.848 pyroblast Fluffy_Pillow 991078.0/1100000: 90% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), rune_of_power
2:52.214 fire_blast Fluffy_Pillow 986117.0/1100000: 90% mana raid_movement, combustion, heating_up, pyretic_incantation(5)
2:52.214 pyroblast Fluffy_Pillow 975117.0/1100000: 89% mana raid_movement, combustion, hot_streak, pyretic_incantation(5), voidsight
2:53.541 fire_blast Fluffy_Pillow 969512.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), voidsight
2:53.541 pyroblast Fluffy_Pillow 958512.5/1100000: 87% mana combustion, hot_streak, pyretic_incantation(5), voidsight
2:54.867 phoenixs_flames Fluffy_Pillow 952891.5/1100000: 87% mana combustion, heating_up, pyretic_incantation(5), voidsight
2:56.192 pyroblast Fluffy_Pillow 974754.0/1100000: 89% mana combustion, hot_streak, pyretic_incantation(5), voidsight
2:57.517 fireball Fluffy_Pillow 969116.5/1100000: 88% mana combustion, heating_up, pyretic_incantation(5), voidsight
2:59.265 living_bomb Fluffy_Pillow 975958.5/1100000: 89% mana heating_up, pyretic_incantation(5), voidsight
3:00.592 pyroblast Fluffy_Pillow 981354.0/1100000: 89% mana hot_streak, pyretic_incantation(5), voidsight
3:01.917 fireball Fluffy_Pillow 975716.5/1100000: 89% mana heating_up, pyretic_incantation(5), voidsight
3:03.666 fireball Fluffy_Pillow 982575.0/1100000: 89% mana heating_up, pyretic_incantation(5), voidsight
3:05.415 pyroblast Fluffy_Pillow 989433.5/1100000: 90% mana hot_streak, pyretic_incantation(5), voidsight
3:06.740 fireball Fluffy_Pillow 983796.0/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
3:08.091 Waiting 0.400 sec 1006087.5/1100000: 91% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:08.491 fire_blast Fluffy_Pillow 1012687.5/1100000: 92% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
3:08.491 pyroblast Fluffy_Pillow 1001687.5/1100000: 91% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), voidsight
3:09.817 counterspell Fluffy_Pillow 996066.5/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), voidsight
3:09.817 fireball Fluffy_Pillow 974066.5/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), voidsight
3:11.566 fireball Fluffy_Pillow 980925.0/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), voidsight
3:13.315 pyroblast Fluffy_Pillow 987783.5/1100000: 90% mana hot_streak, pyretic_incantation(4), voidsight
3:14.640 fireball Fluffy_Pillow 982146.0/1100000: 89% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
3:16.387 fireball Fluffy_Pillow 988971.5/1100000: 90% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
3:18.137 pyroblast Fluffy_Pillow 995846.5/1100000: 91% mana hot_streak, pyretic_incantation(2), voidsight
3:19.463 fireball Fluffy_Pillow 990225.5/1100000: 90% mana hot_streak, pyretic_incantation(4), voidsight
3:20.790 pyroblast Fluffy_Pillow 1012121.0/1100000: 92% mana raid_movement, hot_streak, pyretic_incantation(4), voidsight
3:22.115 living_bomb Fluffy_Pillow 1006483.5/1100000: 91% mana raid_movement, voidsight
3:23.439 Waiting 0.200 sec 1011829.5/1100000: 92% mana raid_movement, voidsight
3:23.639 rune_of_power Fluffy_Pillow 1015129.5/1100000: 92% mana
3:25.006 Waiting 0.200 sec 1037685.0/1100000: 94% mana raid_movement
3:25.206 fireball Fluffy_Pillow 1040985.0/1100000: 95% mana
3:27.007 fireball Fluffy_Pillow 1048701.5/1100000: 95% mana
3:28.808 fire_blast Fluffy_Pillow 1056418.0/1100000: 96% mana heating_up, pyretic_incantation
3:28.808 pyroblast Fluffy_Pillow 1045418.0/1100000: 95% mana hot_streak, pyretic_incantation(2)
3:30.174 fireball Fluffy_Pillow 1040457.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
3:31.976 pyroblast Fluffy_Pillow 1048190.0/1100000: 95% mana hot_streak, pyretic_incantation(4)
3:33.341 fireball Fluffy_Pillow 1043212.5/1100000: 95% mana hot_streak, pyretic_incantation(5)
3:35.142 pyroblast Fluffy_Pillow 1050929.0/1100000: 96% mana hot_streak, pyretic_incantation(5)
3:36.508 living_bomb Fluffy_Pillow 1045968.0/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:37.903 fire_blast Fluffy_Pillow 1052485.5/1100000: 96% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
3:37.903 pyroblast Fluffy_Pillow 1041485.5/1100000: 95% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
3:39.271 fireball Fluffy_Pillow 1036557.5/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
3:40.639 fire_blast Fluffy_Pillow 1059129.5/1100000: 96% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation(3)
3:40.639 pyroblast Fluffy_Pillow 1048129.5/1100000: 95% mana raid_movement, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), voidsight
3:41.964 fireball Fluffy_Pillow 1042492.0/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
3:43.713 fireball Fluffy_Pillow 1049350.5/1100000: 95% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
3:45.460 fireball Fluffy_Pillow 1056176.0/1100000: 96% mana enhanced_pyrotechnics(2), voidsight
3:47.209 counterspell Fluffy_Pillow 1063034.5/1100000: 97% mana heating_up, pyretic_incantation, voidsight
3:47.209 fireball Fluffy_Pillow 1041034.5/1100000: 95% mana heating_up, pyretic_incantation, voidsight
3:48.956 pyroblast Fluffy_Pillow 1047860.0/1100000: 95% mana hot_streak, pyretic_incantation(2), voidsight
3:50.282 living_bomb Fluffy_Pillow 1042239.0/1100000: 95% mana raid_movement, hot_streak, pyretic_incantation(4), voidsight
3:51.608 pyroblast Fluffy_Pillow 1047618.0/1100000: 95% mana raid_movement, hot_streak, pyretic_incantation(4), voidsight
3:52.932 Waiting 0.700 sec 1041964.0/1100000: 95% mana raid_movement, heating_up, pyretic_incantation(5), voidsight
3:53.632 fireball Fluffy_Pillow 1053514.0/1100000: 96% mana heating_up, pyretic_incantation(5), voidsight
3:55.380 fireball Fluffy_Pillow 1060356.0/1100000: 96% mana heating_up, pyretic_incantation(5), voidsight
3:56.736 Waiting 0.500 sec 1082730.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics
3:57.236 fireball Fluffy_Pillow 1090980.0/1100000: 99% mana enhanced_pyrotechnics
3:59.040 fireball Fluffy_Pillow 1078115.5/1100000: 98% mana enhanced_pyrotechnics
4:00.840 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana heating_up, pyretic_incantation, voidsight
4:02.590 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation(2), voidsight
4:03.916 fireball Fluffy_Pillow 1072478.0/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
4:05.665 living_bomb Fluffy_Pillow 1078082.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
4:06.991 rune_of_power Fluffy_Pillow 1083461.5/1100000: 98% mana enhanced_pyrotechnics(2), voidsight
4:08.317 combustion Fluffy_Pillow 1100000.0/1100000: 100% mana enhanced_pyrotechnics(2), rune_of_power, voidsight
4:08.317 phoenixs_flames Fluffy_Pillow 990000.0/1100000: 90% mana combustion, enhanced_pyrotechnics(2), rune_of_power, voidsight
4:09.642 fire_blast Fluffy_Pillow 1011862.5/1100000: 92% mana combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation, rune_of_power, voidsight
4:09.642 pyroblast Fluffy_Pillow 1000862.5/1100000: 91% mana combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(2), rune_of_power, voidsight
4:10.967 fire_blast Fluffy_Pillow 995225.0/1100000: 90% mana combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation(3), rune_of_power, voidsight
4:10.967 flame_on Fluffy_Pillow 984225.0/1100000: 89% mana combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(4), rune_of_power, voidsight
4:10.967 pyroblast Fluffy_Pillow 984225.0/1100000: 89% mana combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(4), rune_of_power, voidsight
4:12.292 fire_blast Fluffy_Pillow 978587.5/1100000: 89% mana raid_movement, combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation(5), rune_of_power, voidsight
4:12.292 pyroblast Fluffy_Pillow 967587.5/1100000: 88% mana raid_movement, combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(5), rune_of_power, voidsight
4:13.618 fire_blast Fluffy_Pillow 961966.5/1100000: 87% mana combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation(5), voidsight
4:13.618 pyroblast Fluffy_Pillow 950966.5/1100000: 86% mana combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(5), voidsight
4:14.945 phoenixs_flames Fluffy_Pillow 945362.0/1100000: 86% mana combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation(5), voidsight
4:16.283 pyroblast Fluffy_Pillow 967439.0/1100000: 88% mana combustion, enhanced_pyrotechnics(2), hot_streak, pyretic_incantation(5)
4:17.650 fireball Fluffy_Pillow 962494.5/1100000: 87% mana combustion, enhanced_pyrotechnics(2), heating_up, pyretic_incantation(5)
4:19.452 fireball Fluffy_Pillow 970227.5/1100000: 88% mana enhanced_pyrotechnics(2), heating_up, pyretic_incantation(5), voidsight
4:20.778 pyroblast Fluffy_Pillow 992106.5/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5), voidsight
4:22.104 living_bomb Fluffy_Pillow 986485.5/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5), voidsight
4:23.430 Waiting 0.200 sec 991864.5/1100000: 90% mana raid_movement, heating_up, pyretic_incantation(5), voidsight
4:23.630 fireball Fluffy_Pillow 995164.5/1100000: 90% mana heating_up, pyretic_incantation(5), voidsight
4:25.378 fireball Fluffy_Pillow 1002006.5/1100000: 91% mana heating_up, pyretic_incantation(5), voidsight
4:27.128 fireball Fluffy_Pillow 1008881.5/1100000: 92% mana enhanced_pyrotechnics, voidsight
4:28.454 fire_blast Fluffy_Pillow 1030760.5/1100000: 94% mana raid_movement, heating_up, pyretic_incantation, voidsight
4:28.454 pyroblast Fluffy_Pillow 1019760.5/1100000: 93% mana raid_movement, hot_streak, pyretic_incantation(2), voidsight
4:29.782 fireball Fluffy_Pillow 1014172.5/1100000: 92% mana heating_up, pyretic_incantation(3), voidsight
4:31.531 fireball Fluffy_Pillow 1021031.0/1100000: 93% mana heating_up, pyretic_incantation(3), voidsight
4:33.279 pyroblast Fluffy_Pillow 1027873.0/1100000: 93% mana hot_streak, pyretic_incantation(4), voidsight
4:34.609 fireball Fluffy_Pillow 1022318.0/1100000: 93% mana heating_up
4:36.411 living_bomb Fluffy_Pillow 1030051.0/1100000: 94% mana heating_up
4:37.778 pyroblast Fluffy_Pillow 1036106.5/1100000: 94% mana hot_streak, pyretic_incantation
4:39.146 fireball Fluffy_Pillow 1031178.5/1100000: 94% mana
4:40.948 rune_of_power Fluffy_Pillow 1038911.5/1100000: 94% mana voidsight
4:42.273 fire_blast Fluffy_Pillow 1060774.0/1100000: 96% mana heating_up, pyretic_incantation, rune_of_power, voidsight
4:42.273 pyroblast Fluffy_Pillow 1049774.0/1100000: 95% mana hot_streak, pyretic_incantation(2), rune_of_power, voidsight
4:43.599 phoenixs_flames Fluffy_Pillow 1044153.0/1100000: 95% mana heating_up, pyretic_incantation(3), rune_of_power, voidsight
4:44.924 pyroblast Fluffy_Pillow 1066015.5/1100000: 97% mana raid_movement, hot_streak, pyretic_incantation(4), rune_of_power, voidsight
4:46.249 fireball Fluffy_Pillow 1060378.0/1100000: 96% mana voidsight
4:47.996 fireball Fluffy_Pillow 1067203.5/1100000: 97% mana voidsight
4:49.745 fireball Fluffy_Pillow 1074062.0/1100000: 98% mana enhanced_pyrotechnics, voidsight
4:51.070 living_bomb Fluffy_Pillow 1095924.5/1100000: 100% mana raid_movement, heating_up, pyretic_incantation, voidsight
4:52.397 fire_blast Fluffy_Pillow 1100000.0/1100000: 100% mana raid_movement, heating_up, pyretic_incantation, voidsight
4:52.397 pyroblast Fluffy_Pillow 1089000.0/1100000: 99% mana raid_movement, hot_streak, pyretic_incantation(2), voidsight
4:53.721 fireball Fluffy_Pillow 1083346.0/1100000: 98% mana voidsight
4:55.469 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana voidsight
4:57.217 fireball Fluffy_Pillow 1078066.0/1100000: 98% mana heating_up, pyretic_incantation
4:59.018 pyroblast Fluffy_Pillow 1078066.0/1100000: 98% mana hot_streak, pyretic_incantation(2)
5:00.384 Waiting 0.200 sec 1073105.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(4)
5:00.584 counterspell Fluffy_Pillow 1076405.0/1100000: 98% mana raid_movement, hot_streak, pyretic_incantation(4)
5:00.584 Waiting 0.600 sec 1054405.0/1100000: 96% mana raid_movement, hot_streak, pyretic_incantation(4)
5:01.184 fireball Fluffy_Pillow 1064305.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
5:02.986 pyroblast Fluffy_Pillow 1072038.0/1100000: 97% mana hot_streak, pyretic_incantation(4)
5:04.353 fireball Fluffy_Pillow 1067093.5/1100000: 97% mana hot_streak, pyretic_incantation(5)
5:06.153 pyroblast Fluffy_Pillow 1074793.5/1100000: 98% mana hot_streak, pyretic_incantation(5)
5:07.518 living_bomb Fluffy_Pillow 1069816.0/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:08.885 fire_blast Fluffy_Pillow 1075871.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:08.885 pyroblast Fluffy_Pillow 1064871.5/1100000: 97% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2)
5:10.252 fireball Fluffy_Pillow 1059927.0/1100000: 96% mana enhanced_pyrotechnics
5:12.053 fireball Fluffy_Pillow 1067643.5/1100000: 97% mana enhanced_pyrotechnics
5:13.854 fire_blast Fluffy_Pillow 1075360.0/1100000: 98% mana heating_up, pyretic_incantation
5:13.854 pyroblast Fluffy_Pillow 1064360.0/1100000: 97% mana hot_streak, pyretic_incantation(2)
5:15.221 fireball Fluffy_Pillow 1059415.5/1100000: 96% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:16.586 Waiting 0.600 sec 1081938.0/1100000: 98% mana raid_movement, enhanced_pyrotechnics, heating_up, pyretic_incantation
5:17.186 fireball Fluffy_Pillow 1091838.0/1100000: 99% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:18.986 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
5:20.786 pyroblast Fluffy_Pillow 1078049.5/1100000: 98% mana hot_streak, pyretic_incantation(2), voidsight
5:22.110 fireball Fluffy_Pillow 1072395.5/1100000: 97% mana heating_up, voidsight
5:23.860 fireball Fluffy_Pillow 1078099.0/1100000: 98% mana heating_up, voidsight
5:25.610 pyroblast Fluffy_Pillow 1078099.0/1100000: 98% mana hot_streak, pyretic_incantation, voidsight
5:26.936 fireball Fluffy_Pillow 1072478.0/1100000: 97% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
5:28.683 fireball Fluffy_Pillow 1078049.5/1100000: 98% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, voidsight
5:30.432 rune_of_power Fluffy_Pillow 1078082.5/1100000: 98% mana hot_streak, pyretic_incantation(2), voidsight
5:31.758 combustion Fluffy_Pillow 1099961.5/1100000: 100% mana enhanced_pyrotechnics, hot_streak, rune_of_power, voidsight
5:31.758 arcane_torrent Fluffy_Pillow 989961.5/1100000: 90% mana combustion, enhanced_pyrotechnics, hot_streak, rune_of_power, voidsight
5:31.758 pyroblast Fluffy_Pillow 1022961.5/1100000: 93% mana combustion, enhanced_pyrotechnics, hot_streak, rune_of_power, voidsight
5:33.085 fire_blast Fluffy_Pillow 1017357.0/1100000: 92% mana raid_movement, combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power, voidsight
5:33.085 pyroblast Fluffy_Pillow 1006357.0/1100000: 91% mana raid_movement, combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power, voidsight
5:34.412 fire_blast Fluffy_Pillow 1000752.5/1100000: 91% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(3), voidsight
5:34.412 flame_on Fluffy_Pillow 989752.5/1100000: 90% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), voidsight
5:34.412 pyroblast Fluffy_Pillow 989752.5/1100000: 90% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), voidsight
5:35.738 fire_blast Fluffy_Pillow 984131.5/1100000: 89% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
5:35.738 pyroblast Fluffy_Pillow 973131.5/1100000: 88% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), voidsight
5:37.062 fire_blast Fluffy_Pillow 967477.5/1100000: 88% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
5:37.062 pyroblast Fluffy_Pillow 956477.5/1100000: 87% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), voidsight
5:38.387 counterspell Fluffy_Pillow 950840.0/1100000: 86% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
5:38.387 phoenixs_flames Fluffy_Pillow 928840.0/1100000: 84% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5), voidsight
5:39.711 pyroblast Fluffy_Pillow 950686.0/1100000: 86% mana combustion, enhanced_pyrotechnics, hot_streak, pyretic_incantation(5), voidsight
5:41.049 fireball Fluffy_Pillow 945263.0/1100000: 86% mana combustion, enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:42.849 fireball Fluffy_Pillow 952963.0/1100000: 87% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(5)
5:44.650 pyroblast Fluffy_Pillow 960679.5/1100000: 87% mana hot_streak, pyretic_incantation(5)
5:46.015 fireball Fluffy_Pillow 955702.0/1100000: 87% mana heating_up
5:47.815 fireball Fluffy_Pillow 963402.0/1100000: 88% mana heating_up, voidsight
5:49.141 pyroblast Fluffy_Pillow 985281.0/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation, voidsight
5:50.467 fireball Fluffy_Pillow 979660.0/1100000: 89% mana voidsight
5:52.216 fireball Fluffy_Pillow 986518.5/1100000: 90% mana voidsight
5:53.964 fireball Fluffy_Pillow 993360.5/1100000: 90% mana enhanced_pyrotechnics, voidsight
5:55.712 fire_blast Fluffy_Pillow 1000202.5/1100000: 91% mana heating_up, pyretic_incantation, voidsight
5:55.712 pyroblast Fluffy_Pillow 989202.5/1100000: 90% mana hot_streak, pyretic_incantation(2), voidsight
5:57.038 fireball Fluffy_Pillow 983581.5/1100000: 89% mana heating_up, voidsight
5:58.786 fireball Fluffy_Pillow 990423.5/1100000: 90% mana heating_up, voidsight
6:00.534 pyroblast Fluffy_Pillow 997265.5/1100000: 91% mana hot_streak, pyretic_incantation, voidsight
6:01.860 fireball Fluffy_Pillow 991644.5/1100000: 90% mana hot_streak, pyretic_incantation(3), voidsight
6:03.610 pyroblast Fluffy_Pillow 998519.5/1100000: 91% mana hot_streak, pyretic_incantation(3)
6:04.978 Waiting 0.200 sec 993591.5/1100000: 90% mana raid_movement, hot_streak, pyretic_incantation(5)
6:05.178 rune_of_power Fluffy_Pillow 996891.5/1100000: 91% mana hot_streak, pyretic_incantation(5)
6:06.543 pyroblast Fluffy_Pillow 1019414.0/1100000: 93% mana hot_streak, pyretic_incantation(5), rune_of_power
6:07.911 fire_blast Fluffy_Pillow 1014486.0/1100000: 92% mana heating_up, pyretic_incantation(5), rune_of_power
6:07.911 pyroblast Fluffy_Pillow 1003486.0/1100000: 91% mana hot_streak, pyretic_incantation(5), rune_of_power
6:09.276 fire_blast Fluffy_Pillow 998508.5/1100000: 91% mana heating_up, pyretic_incantation(5), rune_of_power
6:09.276 pyroblast Fluffy_Pillow 987508.5/1100000: 90% mana hot_streak, pyretic_incantation(5), rune_of_power
6:10.642 phoenixs_flames Fluffy_Pillow 982547.5/1100000: 89% mana rune_of_power
6:12.009 counterspell Fluffy_Pillow 1005103.0/1100000: 91% mana heating_up, pyretic_incantation, rune_of_power
6:12.009 fireball Fluffy_Pillow 983103.0/1100000: 89% mana heating_up, pyretic_incantation, rune_of_power
6:13.810 fireball Fluffy_Pillow 990819.5/1100000: 90% mana heating_up, pyretic_incantation, rune_of_power
6:15.612 pyroblast Fluffy_Pillow 998552.5/1100000: 91% mana hot_streak, pyretic_incantation(2), rune_of_power
6:16.978 fireball Fluffy_Pillow 993591.5/1100000: 90% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:18.780 fireball Fluffy_Pillow 1001324.5/1100000: 91% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:20.147 pyroblast Fluffy_Pillow 1023880.0/1100000: 93% mana raid_movement, hot_streak, pyretic_incantation(2)
6:21.513 fireball Fluffy_Pillow 1018919.0/1100000: 93% mana heating_up, pyretic_incantation(3)
6:23.314 fire_blast Fluffy_Pillow 1026635.5/1100000: 93% mana heating_up, pyretic_incantation(3)
6:23.314 pyroblast Fluffy_Pillow 1015635.5/1100000: 92% mana hot_streak, pyretic_incantation(4)
6:24.682 rune_of_power Fluffy_Pillow 1010707.5/1100000: 92% mana enhanced_pyrotechnics, heating_up, pyretic_incantation
6:26.049 flame_on Fluffy_Pillow 1033263.0/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:26.049 fire_blast Fluffy_Pillow 1033263.0/1100000: 94% mana enhanced_pyrotechnics, heating_up, pyretic_incantation, rune_of_power
6:26.049 pyroblast Fluffy_Pillow 1022263.0/1100000: 93% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(2), rune_of_power
6:27.416 fire_blast Fluffy_Pillow 1017318.5/1100000: 92% mana enhanced_pyrotechnics, heating_up, pyretic_incantation(3), rune_of_power
6:27.416 pyroblast Fluffy_Pillow 1006318.5/1100000: 91% mana enhanced_pyrotechnics, hot_streak, pyretic_incantation(4), rune_of_power
6:28.783 fireball Fluffy_Pillow 1001374.0/1100000: 91% mana enhanced_pyrotechnics, rune_of_power
6:30.583 fireball Fluffy_Pillow 1009074.0/1100000: 92% mana enhanced_pyrotechnics, rune_of_power
6:32.385 fireball Fluffy_Pillow 1016807.0/1100000: 92% mana heating_up, pyretic_incantation, rune_of_power
6:34.188 fireball Fluffy_Pillow 1024556.5/1100000: 93% mana enhanced_pyrotechnics, rune_of_power

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4872 4547 0
Agility 6579 6254 0
Stamina 29175 29175 18947
Intellect 30778 29071 20357 (729)
Spirit 2 2 0
Health 1750500 1750500 0
Mana 1100000 1100000 0
Spell Power 30778 29071 0
Crit 33.53% 32.46% 9262
Haste 10.11% 10.11% 3286
Damage / Heal Versatility 0.00% 0.00% 0
ManaReg per Second 16500 16500 0
Mastery 17.14% 17.14% 5197
Armor 1580 1580 1580
Run Speed 7 0 961

Gear

Source Slot Average Item Level: 847.00
Local Head Hood of Ancient Evil
ilevel: 840, stats: { 204 Armor, +1182 Int, +1773 Sta, +791 Crit, +467 Mastery }
Local Neck Tightweb Choker
ilevel: 890, stats: { +1589 Sta, +1218 Haste, +914 Crit }
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 825, stats: { 178 Armor, +771 Int, +1157 Sta, +561 Mastery, +331 Crit }
Local Chest Arcane Singed Robe
ilevel: 845, stats: { 256 Armor, +1238 Int, +1857 Sta, +777 Mastery, +503 Crit, +549 RunSpeed }
Local Waist Waistband of Spiritual Doom
ilevel: 840, stats: { 141 Armor, +1329 Sta, +886 Int, +633 Haste, +310 Crit }
Local Legs Bonespeaker Leggings
ilevel: 855, stats: { 232 Armor, +1359 Int, +2039 Sta, +950 Crit, +380 Mastery }
Local Feet Terrorweave Boots
ilevel: 840, stats: { 173 Armor, +886 Int, +1329 Sta, +633 Crit, +310 Haste }
Local Wrists Bracers of Tirisgarde
ilevel: 830, stats: { 106 Armor, +908 Sta, +605 Int, +471 Crit, +208 Mastery }, gems: { +150 Crit }
Local Hands Gloves of Unseen Evil
ilevel: 845, stats: { 160 Armor, +1393 Sta, +929 Int, +666 Crit, +295 Mastery, +412 RunSpeed }
Local Finger1 Prophetic Band of the Peerless
ilevel: 855, stats: { +1147 Sta, +1203 Crit, +668 Mastery }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Finger2 Rough-Hammered Silver Ring
ilevel: 850, stats: { +1094 Sta, +314 Avoidance, +1206 Crit, +629 Mastery }, gems: { +150 Crit }
Local Trinket1 Orb of Voidsight
ilevel: 815, stats: { +890 Int }
Local Trinket2 Bleached Skull Talisman
ilevel: 845, stats: { +1177 Int, +915 Mastery }
Local Back Nightmare Shroud
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +445 Crit, +288 Haste }
Local Main Hand Felo'melorn
ilevel: 866, weapon: { 1912 - 3553, 2.6 }, stats: { +645 Int, +968 Sta, +297 Haste, +297 Mastery, +8213 Int }, relics: { +40 ilevels, +40 ilevels, +36 ilevels }
Local Off Hand Heart of the Phoenix
ilevel: 866, stats: { +847 Int, +1270 Sta, +540 Haste, +239 Crit }

Talents

Level
15 Pyromaniac (Fire Mage) Conflagration (Fire Mage) Firestarter (Fire Mage)
30 Shimmer Cauterize Cold Snap
45 Mirror Image Rune of Power Incanter's Flow
60 Blast Wave (Fire Mage) Flame On (Fire Mage) Controlled Burn (Fire Mage)
75 Ice Floes Ring of Frost Ice Ward
90 Living Bomb (Fire Mage) Unstable Magic Flame Patch (Fire Mage)
100 Kindling (Fire Mage) Cinderstorm (Fire Mage) Meteor (Fire Mage)

Profile

mage="Morepyro"
origin="https://us.api.battle.net/wow/character/thrall/Morepyro/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/189/161949885-avatar.jpg"
level=110
race=blood_elf
role=spell
position=back
professions=tailoring=727/enchanting=727
talents=2122111
artifact=54:0:0:0:0:748:1:749:3:751:3:754:3:756:3:759:1:763:1:1340:1
spec=fire

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=the_hungry_magister
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/snapshot_stats
actions.precombat+=/mirror_image
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/pyroblast

# Executed every time the actor is available.
actions=counterspell,if=target.debuff.casting.react
actions+=/time_warp,if=(time=0&buff.bloodlust.down)|(buff.bloodlust.down&equipped.132410)
actions+=/mirror_image,if=buff.combustion.down
actions+=/rune_of_power,if=cooldown.combustion.remains>40&buff.combustion.down&(cooldown.flame_on.remains<5|cooldown.flame_on.remains>30)&!talent.kindling.enabled|target.time_to_die.remains<11|talent.kindling.enabled&(charges_fractional>1.8|time<40)&cooldown.combustion.remains>40
actions+=/call_action_list,name=combustion_phase,if=cooldown.combustion.remains<=action.rune_of_power.cast_time+(!talent.kindling.enabled*gcd)|buff.combustion.up
actions+=/call_action_list,name=rop_phase,if=buff.rune_of_power.up&buff.combustion.down
actions+=/call_action_list,name=single_target

actions.active_talents=flame_on,if=action.fire_blast.charges=0&(cooldown.combustion.remains>40+(talent.kindling.enabled*25)|target.time_to_die.remains<cooldown.combustion.remains)
actions.active_talents+=/blast_wave,if=(buff.combustion.down)|(buff.combustion.up&action.fire_blast.charges<1&action.phoenixs_flames.charges<1)
actions.active_talents+=/meteor,if=cooldown.combustion.remains>30|(cooldown.combustion.remains>target.time_to_die)|buff.rune_of_power.up
actions.active_talents+=/cinderstorm,if=cooldown.combustion.remains<cast_time&(buff.rune_of_power.up|!talent.rune_on_power.enabled)|cooldown.combustion.remains>10*spell_haste&!buff.combustion.up
actions.active_talents+=/dragons_breath,if=equipped.132863
actions.active_talents+=/living_bomb,if=active_enemies>1&buff.combustion.down

actions.combustion_phase=rune_of_power,if=buff.combustion.down
actions.combustion_phase+=/call_action_list,name=active_talents
actions.combustion_phase+=/combustion
actions.combustion_phase+=/potion,name=deadly_grace
actions.combustion_phase+=/blood_fury
actions.combustion_phase+=/berserking
actions.combustion_phase+=/arcane_torrent
actions.combustion_phase+=/pyroblast,if=buff.hot_streak.up
actions.combustion_phase+=/fire_blast,if=buff.heating_up.up
actions.combustion_phase+=/phoenixs_flames
actions.combustion_phase+=/scorch,if=buff.combustion.remains>cast_time
actions.combustion_phase+=/scorch,if=target.health.pct<=25&equipped.132454

actions.rop_phase=rune_of_power
actions.rop_phase+=/pyroblast,if=buff.hot_streak.up
actions.rop_phase+=/call_action_list,name=active_talents
actions.rop_phase+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.rop_phase+=/fire_blast,if=!prev_off_gcd.fire_blast
actions.rop_phase+=/phoenixs_flames,if=!prev_gcd.phoenixs_flames
actions.rop_phase+=/scorch,if=target.health.pct<=25&equipped.132454
actions.rop_phase+=/fireball

actions.single_target=pyroblast,if=buff.hot_streak.up&buff.hot_streak.remains<action.fireball.execute_time
actions.single_target+=/phoenixs_flames,if=charges_fractional>2.7&active_enemies>2
actions.single_target+=/flamestrike,if=talent.flame_patch.enabled&active_enemies>2&buff.hot_streak.react
actions.single_target+=/pyroblast,if=buff.hot_streak.up&!prev_gcd.pyroblast
actions.single_target+=/pyroblast,if=buff.hot_streak.react&target.health.pct<=25&equipped.132454
actions.single_target+=/pyroblast,if=buff.kaelthas_ultimate_ability.react
actions.single_target+=/call_action_list,name=active_talents
actions.single_target+=/fire_blast,if=!talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.4|cooldown.combustion.remains<40)&(3-charges_fractional)*(12*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/fire_blast,if=talent.kindling.enabled&buff.heating_up.up&(!talent.rune_of_power.enabled|charges_fractional>1.5|cooldown.combustion.remains<40)&(3-charges_fractional)*(18*spell_haste)<cooldown.combustion.remains+3|target.time_to_die.remains<4
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up|buff.incanters_flow.stack>3|talent.mirror_image.enabled)&artifact.phoenix_reborn.enabled&(4-charges_fractional)*13<cooldown.combustion.remains+5|target.time_to_die.remains<10
actions.single_target+=/phoenixs_flames,if=(buff.combustion.up|buff.rune_of_power.up)&(4-charges_fractional)*30<cooldown.combustion.remains+5
actions.single_target+=/scorch,if=target.health.pct<=25&equipped.132454
actions.single_target+=/fireball

head=hood_of_ancient_evil,id=134425,bonus_id=1727/1492/1813
neck=tightweb_choker,id=134541,bonus_id=1727/1542/3337
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=1726/1477
back=nightmare_shroud,id=121307,bonus_id=3474/1512/3336
chest=arcane_singed_robe,id=134351,bonus_id=3474/42/1507/1674
wrists=bracers_of_tirisgarde,id=139754,bonus_id=3385/3383,gems=150crit
hands=gloves_of_unseen_evil,id=137506,bonus_id=1726/42/1497/3337
waist=waistband_of_spiritual_doom,id=137507,bonus_id=1727/1492/1813
legs=bonespeaker_leggings,id=134218,bonus_id=3473/1517/3337
feet=terrorweave_boots,id=121328,bonus_id=3473/1502/1674
finger1=prophetic_band,id=130229,bonus_id=3347/689/601/670,gems=150crit,enchant=150crit
finger2=roughhammered_silver_ring,id=134191,bonus_id=3432/1808/40/1512/3337,gems=150crit
trinket1=orb_of_voidsight,id=133596
trinket2=bleached_skull_talisman,id=134204,bonus_id=3474/605/1507/1674
main_hand=felomelorn,id=128820,bonus_id=730,gem_id=143701/137303/142059/0,relic_id=3473:1502:1674/1726:1492:3337/0/0
off_hand=heart_of_the_phoenix,id=133959

# Gear Summary
# gear_ilvl=847.31
# gear_stamina=18947
# gear_intellect=20357
# gear_crit_rating=9262
# gear_haste_rating=3286
# gear_mastery_rating=5197
# gear_speed_rating=961
# gear_avoidance_rating=314
# gear_armor=1580

Zipi

Zipi : 424188 dps, 257998 dps to main target

  • Race: Tauren
  • Class: Paladin
  • Spec: Retribution
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
424187.6 424187.6 405.2 / 0.096% 77645.9 / 18.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 11.22% 57.0 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Zipi/advanced
Talents
  • 15: Execution Sentence (Retribution Paladin)
  • 30: Zeal (Retribution Paladin)
  • 45: Blinding Light
  • 60: Virtue's Blade (Retribution Paladin)
  • 75: Eye for an Eye (Retribution Paladin)
  • 90: Cavalier (Retribution Paladin)
  • 100: Holy Wrath (Retribution Paladin)
  • Talent Calculator
Artifact
Professions
  • mining: 714
  • herbalism: 673
Scale Factors for Zipi Damage Per Second
Haste Str Vers Crit Mastery
Scale Factors 20.41 12.00 10.62 10.33 6.36
Normalized 1.70 1.00 0.89 0.86 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.51 0.51 0.51 0.51
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.00, CritRating=10.33, HasteRating=20.41, MasteryRating=6.36, Versatility=10.62 )

Scale Factors for other metrics

Scale Factors for Zipi Damage Per Second
Haste Str Vers Crit Mastery
Scale Factors 20.41 12.00 10.62 10.33 6.36
Normalized 1.70 1.00 0.89 0.86 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.55 0.51 0.51 0.51 0.51
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Vers ~= Crit > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.00, CritRating=10.33, HasteRating=20.41, MasteryRating=6.36, Versatility=10.62 )
Scale Factors for Zipi Priority Target Damage Per Second
Str Crit Vers Mastery Haste
Scale Factors 7.21 6.55 6.44 4.74 4.29
Normalized 1.00 0.91 0.89 0.66 0.60
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.17 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Str > Crit ~= Vers > Mastery > Haste
Pawn string ( Pawn: v1: "Zipi": Strength=7.21, CritRating=6.55, HasteRating=4.29, MasteryRating=4.74, Versatility=6.44 )
Scale Factors for Zipi Damage Per Second (Effective)
Haste Str Vers Crit Mastery
Scale Factors 20.41 12.00 10.62 10.33 6.36
Normalized 1.70 1.00 0.89 0.86 0.53
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Str > Vers > Crit > Mastery
Pawn string ( Pawn: v1: "Zipi": Strength=12.00, CritRating=10.33, HasteRating=20.41, MasteryRating=6.36, Versatility=10.62 )
Scale Factors for Zipi Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for Zipi Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )
Scale Factors for ZipiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Zipi": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Zipi 424188
Blade of Justice 36294 8.6% 51.4 7.81sec 282672 269897 Direct 51.4 183869 566122 282679 25.8%  

Stats details: blade_of_justice

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 51.38 51.38 0.00 0.00 1.0474 0.0000 14522893.97 21350029.77 31.98 269897.12 269897.12
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 38.10 74.15% 183869.19 160240 246494 183861.21 171646 196481 7004907 10297876 31.98
crit 13.28 25.85% 566122.12 493538 759203 566139.13 496805 753954 7517987 11052153 31.98
 
 

Action details: blade_of_justice

Static Values
  • id:184575
  • school:physical
  • resource:none
  • range:12.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
Spelldata
  • id:184575
  • name:Blade of Justice
  • school:physical
  • tooltip:
  • description:Strikes an enemy with the Blade of Justice, dealing ${$sw2*$<mult>} Physical damage. |cFFFFFFFFGenerates {$s3=2} Holy Power.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
Greater Blessing of Might (blessing_of_might_proc) 31842 7.5% 365.2 2.00sec 34724 0 Direct 269.5 47047 0 47047 0.0%  

Stats details: blessing_of_might_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 365.17 269.52 0.00 0.00 0.0000 0.0000 12680305.07 12680305.07 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 269.52 100.00% 47046.93 6410 242721 47016.27 39512 55482 12680305 12680305 0.00
 
 

Action details: blessing_of_might_proc

Static Values
  • id:205729
  • school:holy
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205729
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:
  • description:{$@spelldesc203528=Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:48490.70
  • base_dd_max:48490.70
 
Divine Storm 104827 24.5% 41.4 7.08sec 1000611 950010 Direct 248.1 131465 269457 166768 25.6%  

Stats details: divine_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.36 248.13 0.00 0.00 1.0533 0.0000 41380517.70 41380517.70 0.00 950009.59 950009.59
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 184.65 74.42% 131464.95 102434 220405 131469.41 126896 137136 24274941 24274941 0.00
crit 63.48 25.58% 269456.52 208965 449626 269481.01 241976 299052 17105577 17105577 0.00
 
 

Action details: divine_storm

Static Values
  • id:53385
  • school:holy
  • resource:holy_power
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:53385
  • name:Divine Storm
  • school:holy
  • tooltip:
  • description:Unleashes a whirl of divine energy, dealing $224239sw1 Holy damage to all nearby enemies.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Execution Sentence 25108 6.0% 17.0 24.47sec 597121 539210 Periodic 16.7 478926 975689 608193 26.0% 21.3%

Stats details: execution_sentence

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.97 0.00 16.67 16.67 1.1074 5.1110 10136073.56 10136073.56 0.00 97487.56 539210.21
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 12.3 73.97% 478926.00 311388 661900 478521.45 433854 541228 5904133 5904133 0.00
crit 4.3 26.03% 975689.09 635232 1350276 966932.91 0 1349901 4231941 4231941 0.00
 
 

Action details: execution_sentence

Static Values
  • id:213757
  • school:holy
  • resource:holy_power
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
Spelldata
  • id:213757
  • name:Execution Sentence
  • school:holy
  • tooltip:Taking $s2 Holy damage when this expires.
  • description:A hammer slowly falls from the sky, dealing $s2 Holy damage after {$d=7 seconds}.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:11.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:7.00
  • base_tick_time:7.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Judgment 27299 6.5% 44.8 8.95sec 243902 230581 Direct 44.8 192103 392245 243944 25.9%  

Stats details: judgment

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.80 44.79 0.00 0.00 1.0578 0.0000 10927021.12 10927021.12 0.00 230581.38 230581.38
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.19 74.10% 192102.95 167963 259341 192126.04 178726 206473 6375856 6375856 0.00
crit 11.60 25.90% 392245.34 342645 529055 392348.12 345496 480599 4551165 4551165 0.00
 
 

Action details: judgment

Static Values
  • id:20271
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:35.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20271
  • name:Judgment
  • school:holy
  • tooltip:
  • description:Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:0.00
  • base_dd_max:0.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Judgment (_aoe) 13549 3.2% 44.8 8.95sec 119399 0 Direct 23.0 182975 374735 232525 25.8%  

Stats details: judgment_aoe

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 44.79 23.00 0.00 0.00 0.0000 0.0000 5348220.47 5348220.47 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.06 74.16% 182975.39 156074 240984 182970.24 164254 204242 3120856 3120856 0.00
crit 5.94 25.84% 374735.02 318391 491607 374499.55 0 491607 2227365 2227365 0.00
 
 

Action details: judgment_aoe

Static Values
  • id:228288
  • school:holy
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:228288
  • name:Judgment
  • school:holy
  • tooltip:
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${{$231661s1=1}+{$218178s2=2}} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing {$s1=0} Holy damage{$?s76672=false}|a231663[, and causing them to take {$197277s1=0}% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by {$231657s1=2} sec, or ${{$231657s1=2}*2} sec on a critical strike][].}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Mark of the Hidden Satyr 7689 1.8% 27.5 14.66sec 111972 0 Direct 27.5 88319 180456 111974 25.7%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.48 27.48 0.00 0.00 0.0000 0.0000 3076884.31 3076884.31 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.42 74.33% 88318.71 76412 118657 88328.32 77651 101675 1803872 1803872 0.00
crit 7.05 25.67% 180455.99 155880 242061 180295.37 0 242061 1273013 1273013 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
melee 11833 2.8% 113.9 3.51sec 41680 16779 Direct 113.9 32848 67128 41680 25.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 113.90 113.90 0.00 0.00 2.4840 0.0000 4747570.76 6979378.72 31.98 16779.25 16779.25
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 84.56 74.24% 32848.28 27919 44140 32854.79 31210 34429 2777588 4083317 31.98
crit 29.35 25.76% 67128.36 58314 90046 67142.20 59857 76127 1969983 2896061 31.98
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:3.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 14940 3.5% 28.7 5.45sec 205313 0 Direct 28.7 162051 332348 205310 25.4%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.72 28.72 0.00 0.00 0.0000 0.0000 5896611.06 8668576.80 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 21.42 74.60% 162050.60 115571 176245 162059.23 151167 171391 3471833 5103924 31.98
crit 7.30 25.40% 332347.93 268771 359541 332209.14 0 359541 2424778 3564653 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Templar's Verdict 31528 7.6% 35.4 11.38sec 361145 334289 Direct 35.4 284287 579233 361151 26.1%  

Stats details: templars_verdict

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.43 35.43 0.00 0.00 1.0804 0.0000 12794249.76 12794249.76 0.00 334289.18 334289.18
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.20 73.94% 284287.09 259617 396603 284088.60 262214 308666 7446902 7446902 0.00
crit 9.23 26.06% 579233.32 529619 809071 578743.04 0 790891 5347347 5347347 0.00
 
 

Action details: templars_verdict

Static Values
  • id:85256
  • school:holy
  • resource:holy_power
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:3.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
Spelldata
  • id:85256
  • name:Templar's Verdict
  • school:holy
  • tooltip:
  • description:A powerful weapon strike that deals ${$224266sw1*$<mult>} Holy damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Wake of Ashes 43097 10.1% 13.1 31.91sec 1308882 1133572 Direct 46.3 183735 374948 232534 25.5%  
Periodic 157.7 31709 64635 40178 25.7% 39.4%

Stats details: wake_of_ashes

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.07 46.29 157.74 157.74 1.1547 1.0000 17101074.35 17101074.35 0.00 98946.80 1133572.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 34.48 74.48% 183734.53 174929 248404 183712.91 182918 186076 6334547 6334547 0.00
crit 11.81 25.52% 374947.55 356855 506744 374903.15 369070 401642 4428715 4428715 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 117.2 74.28% 31709.01 29603 47487 31703.14 31261 32478 3715380 3715380 0.00
crit 40.6 25.72% 64635.21 60391 96873 64622.27 63120 69239 2622432 2622432 0.00
 
 

Action details: wake_of_ashes

Static Values
  • id:205273
  • school:holyfire
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:30.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:holy_power>=0&time<2
Spelldata
  • id:205273
  • name:Wake of Ashes
  • school:holyfire
  • tooltip:Movement speed reduced by {$s2=50}%. $?$w3!=0[Suffering {$s3=0} Radiant damage every $t3 sec][]
  • description:Lash out with the |cFFFFCC99Ashbringer|r, dealing $sw1 Radiant damage$?a179546[, and an additional $o3 Radiant damage over {$d=6 seconds},][] to all enemies within $a1 yd in front of you, and reducing movement speed by {$s2=50}% for {$d=6 seconds}. Demon and Undead enemies are stunned for {$205290d=6 seconds} if struck by the Wake of Ashes.$?a179546[ |cFFFFFFFFGenerates {$218001s1=5} Holy Power.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:6.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.100000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:6.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Zeal 76181 18.0% 119.6 3.34sec 253783 238409 Direct 290.8 71615 146546 104377 43.7%  

Stats details: zeal

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 119.60 290.80 0.00 0.00 1.0645 0.0000 30353026.08 44621823.46 31.98 238408.88 238408.88
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 163.65 56.28% 71614.69 21368 152710 71518.07 60537 82485 11719810 17229231 31.98
crit 127.15 43.72% 146546.29 43591 311529 146351.13 123739 172164 18633216 27392592 31.98
 
 

Action details: zeal

Static Values
  • id:217020
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:charges=2&holy_power<=4
Spelldata
  • id:217020
  • name:Zeal
  • school:physical
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Simple Action Stats Execute Interval
Zipi
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Crusade 3.6 125.97sec

Stats details: crusade

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 3.64 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crusade

Static Values
  • id:231895
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:holy_power>=5
Spelldata
  • id:231895
  • name:Crusade
  • school:holy
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Zipi
  • harmful:false
  • if_expr:
 
Greater Blessing of Might 1.0 0.00sec

Stats details: greater_blessing_of_might

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
heal 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: greater_blessing_of_might

Static Values
  • id:203528
  • school:holy
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:
Spelldata
  • id:203528
  • name:Greater Blessing of Might
  • school:holy
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Rebuke 13.2 30.90sec

Stats details: rebuke

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 13.25 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: rebuke

Static Values
  • id:96231
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:15.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:96231
  • name:Rebuke
  • school:physical
  • tooltip:
  • description:Interrupts spellcasting and prevents any spell in that school from being cast for {$d=4 seconds}.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Shield of Vengeance 4.9 90.00sec

Stats details: shield_of_vengeance

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 4.95 4.95 0.00 0.00 0.0000 0.0000 0.00 3489929.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.72 75.17% 0.00 0 0 0.00 0 0 0 2083613 99.91
crit 1.23 24.83% 0.00 0 0 0.00 0 0 0 1406316 75.46
 
 

Action details: shield_of_vengeance

Static Values
  • id:184662
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Healing_Target
  • harmful:false
  • if_expr:
Spelldata
  • id:184662
  • name:Shield of Vengeance
  • school:holy
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
 
shield_of_vengeance_proc 4.9 89.66sec

Stats details: shield_of_vengeance_proc

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.95 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_of_vengeance_proc

Static Values
  • id:184689
  • school:holy
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 29.97% 0.0(0.0) 1.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Chaotic Energy 1.0 112.9 0.0sec 3.5sec 99.39% 99.39% 93.9(93.9) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_chaotic_energy
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:66.50

Stack Uptimes

  • chaotic_energy_1:0.48%
  • chaotic_energy_2:0.48%
  • chaotic_energy_3:0.44%
  • chaotic_energy_4:0.41%
  • chaotic_energy_5:0.38%
  • chaotic_energy_6:0.99%
  • chaotic_energy_7:0.36%
  • chaotic_energy_8:0.36%
  • chaotic_energy_9:0.36%
  • chaotic_energy_10:1.46%
  • chaotic_energy_11:0.36%
  • chaotic_energy_12:0.36%
  • chaotic_energy_13:0.89%
  • chaotic_energy_14:0.55%
  • chaotic_energy_15:0.55%
  • chaotic_energy_16:0.55%
  • chaotic_energy_17:0.55%
  • chaotic_energy_18:0.64%
  • chaotic_energy_19:1.36%
  • chaotic_energy_20:87.84%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214831
  • name:Chaotic Energy
  • tooltip:Strength or Agility increased by $w3.
  • description:{$@spelldesc214829=Your melee autoattacks grant you Chaotic Energy, increasing your Strength or Agility by {$214831s3=50}, stacking up to {$214831u=20} times. If you do not autoattack an enemy for 4 sec, this effect will decrease by 1 stack every sec.}
  • max_stacks:20
  • duration:23.00
  • cooldown:0.00
  • default_chance:101.00%
Crusade 3.6 28.3 126.0sec 11.5sec 24.36% 100.00% 13.9(34.7) 3.5

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_crusade
  • max_stacks:15
  • duration:27.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crusade_1:0.31%
  • crusade_4:3.11%
  • crusade_7:2.75%
  • crusade_10:3.25%
  • crusade_13:4.04%
  • crusade_15:10.89%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:231895
  • name:Crusade
  • tooltip:Damage and haste increased by ${{$s1=35}/10}.1%.
  • description:Increases your damage and haste by ${{$s1=35}/10}.1% for {$d=20 seconds}. Each Holy Power spent during Crusade increases damage and haste by an additional ${{$s1=35}/10}.1%. Maximum {$u=15} stacks.
  • max_stacks:15
  • duration:20.00
  • cooldown:20.00
  • default_chance:100.00%
Legion's Gaze 4.6 109.3 65.2sec 3.5sec 97.74% 97.74% 74.0(74.0) 3.6

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_legions_gaze
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:140.95

Stack Uptimes

  • legions_gaze_1:3.09%
  • legions_gaze_2:4.35%
  • legions_gaze_3:3.68%
  • legions_gaze_4:3.76%
  • legions_gaze_5:3.43%
  • legions_gaze_6:6.41%
  • legions_gaze_7:2.82%
  • legions_gaze_8:3.05%
  • legions_gaze_9:1.33%
  • legions_gaze_10:65.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:230152
  • name:Legion's Gaze
  • tooltip:Critical Strike increased by $w1. This effect is reset if you auto attack a different target.
  • description:{$@spelldesc230150=Your melee auto attacks increase your Critical Strike by {$230152s1=124} for {$230152d=10 seconds}, stacking up to {$230152u=10} times. This effect is reset if you auto attack a different target.}
  • max_stacks:10
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%
Potion of the Old War 2.0 0.0 129.5sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 4.9 0.0 90.0sec 90.0sec 18.20% 18.20% 0.0(0.0) 4.8

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:18.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Zeal 1.0 118.6 0.0sec 3.3sec 99.49% 99.15% 116.6(116.6) 0.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_zeal
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • zeal_1:0.81%
  • zeal_2:0.19%
  • zeal_3:98.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:217020
  • name:Zeal
  • tooltip:Chains to an additonal nearby target per stack.
  • description:Strike the target for $sw2 Physical damage. Maximum {$s5=2} charges. Grants Zeal, causing Zeal attacks to chain to an additional nearby target per stack. Maximum {$u=3} stacks. Each jump deals {$s6=40}% less damage. |cFFFFFFFFGenerates {$s3=1} Holy Power.
  • max_stacks:3
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Greater Blessing of Might (blessing_of_might)

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_blessing_of_might
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blessing_of_might_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203528
  • name:Greater Blessing of Might
  • tooltip:Attacks have a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy.
  • description:Places a blessing on an ally that gives their attacks a {$s1=10}% chance to deal {$s2=30}% additional damage as Holy. You may only have 3 Greater Blessings active at one time.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
Defiled Augmentation

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Zipi
divine_storm Holy Power 41.4 124.1 3.0 3.0 333537.5
execution_sentence Holy Power 17.0 50.9 3.0 3.0 199040.3
templars_verdict Holy Power 35.4 106.3 3.0 3.0 120381.4
Resource Gains Type Count Total Average Overflow
wake_of_ashes Holy Power 13.07 61.28 (21.60%) 4.69 4.05 6.20%
zeal Holy Power 119.60 119.60 (42.17%) 1.00 0.00 0.00%
blade_of_justice Holy Power 51.38 102.75 (36.23%) 2.00 0.00 0.00%
Resource RPS-Gain RPS-Loss
Holy Power 0.71 0.70
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Holy Power 2.36 0.00 5.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Zipi Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Zipi Damage Per Second
Count 9999
Mean 424187.59
Minimum 369842.33
Maximum 501998.70
Spread ( max - min ) 132156.38
Range [ ( max - min ) / 2 * 100% ] 15.58%
Standard Deviation 20672.5770
5th Percentile 392684.40
95th Percentile 461702.89
( 95th Percentile - 5th Percentile ) 69018.49
Mean Distribution
Standard Deviation 206.7361
95.00% Confidence Intervall ( 423782.39 - 424592.78 )
Normalized 95.00% Confidence Intervall ( 99.90% - 100.10% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 91
0.1% Error 9123
0.1 Scale Factor Error with Delta=300 3648151
0.05 Scale Factor Error with Delta=300 14592607
0.01 Scale Factor Error with Delta=300 364815181
Priority Target DPS
Sample Data Zipi Priority Target Damage Per Second
Count 9999
Mean 257998.13
Minimum 229397.92
Maximum 287908.15
Spread ( max - min ) 58510.23
Range [ ( max - min ) / 2 * 100% ] 11.34%
Standard Deviation 6904.7043
5th Percentile 246601.02
95th Percentile 269363.15
( 95th Percentile - 5th Percentile ) 22762.13
Mean Distribution
Standard Deviation 69.0505
95.00% Confidence Intervall ( 257862.80 - 258133.47 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 27
0.1% Error 2751
0.1 Scale Factor Error with Delta=300 406980
0.05 Scale Factor Error with Delta=300 1627922
0.01 Scale Factor Error with Delta=300 40698071
DPS(e)
Sample Data Zipi Damage Per Second (Effective)
Count 9999
Mean 424187.59
Minimum 369842.33
Maximum 501998.70
Spread ( max - min ) 132156.38
Range [ ( max - min ) / 2 * 100% ] 15.58%
Damage
Sample Data Zipi Damage
Count 9999
Mean 168964448.20
Minimum 139863201.13
Maximum 199934309.69
Spread ( max - min ) 60071108.56
Range [ ( max - min ) / 2 * 100% ] 17.78%
DTPS
Sample Data Zipi Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Zipi Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Zipi Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Zipi Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Zipi Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Zipi Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data ZipiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Zipi Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_countless_armies
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 greater_blessing_of_might
4 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
5 0.00 potion,name=old_war
Default action list Executed every time the actor is available.
# count action,conditions
6 33.04 auto_attack
7 13.25 rebuke
8 1.00 potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
0.00 holy_wrath
0.00 avenging_wrath
9 4.95 shield_of_vengeance
A 3.64 crusade,if=holy_power>=5
B 1.00 wake_of_ashes,if=holy_power>=0&time<2
C 16.98 execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=holy_power<5
D 0.00 call_action_list,name=VB,if=talent.virtues_blade.enabled
E 0.00 call_action_list,name=DH,if=talent.divine_hammer.enabled
actions.VB
# count action,conditions
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
F 8.29 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
0.00 templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
G 10.90 templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
H 6.29 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
I 3.28 templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
J 12.07 wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
K 18.14 zeal,if=charges=2&holy_power<=4
0.00 crusader_strike,if=charges=2&holy_power<=4
L 51.38 blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
M 46.12 judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
0.00 consecration
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
0.00 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
N 16.42 divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
0.00 justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
0.00 templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
0.00 templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
O 15.26 templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
P 102.27 zeal,if=holy_power<=4
0.00 crusader_strike,if=holy_power<=4
Q 10.36 divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
R 5.99 templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

Sample Sequence

0123569BAC7KLMGKPOPLOMPPC6LPMRPLPOMLQ6KPMLNK6PHJFKLMFKPNP7LCMP6PLGPPQM6KLPNPM6PHJFLKCPMPOL67POPM6PLFPQP9ML6HJFKPCLMPOP6PLMF67PPNLPMNP6PHJA8CLMKGPPOLPM6NPLNPMPQLP7QMPLQ6PJCLMOKPRPLMM6PNPLN9PMPQPLH67JCPMPOLPOM6K6LN7KPQPLMPNP6LCJM7GKPOLQ6PMP6PLFPMPNL7PC6PMPIJAGLN6K7MPPNL6P9NMPLNPPMQLPCPM6LPIJ7GLMN6KPQPL6MPNPLNPMPCPL6IJMGKPOLPC7MP6PLGPRMPLPCPM6LIJGKPMO9LPC6PPMLG7PRPPLCM6PPIJAGLMOKPRP

Sample Sequence Table

time name target resources buffs
Pre flask Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre food Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre augmentation Zipi 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre greater_blessing_of_might Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 0.0/5: 0% holy_power potion_of_the_old_war
0:00.000 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power shield_of_vengeance, potion_of_the_old_war
0:01.140 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, shield_of_vengeance, potion_of_the_old_war
0:01.140 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade, shield_of_vengeance, potion_of_the_old_war
0:02.020 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.020 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(4), shield_of_vengeance, potion_of_the_old_war
0:02.818 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, legions_gaze, potion_of_the_old_war
0:03.616 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy, legions_gaze, potion_of_the_old_war
0:04.415 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, crusade(4), zeal, shield_of_vengeance, chaotic_energy(2), legions_gaze(2), potion_of_the_old_war
0:05.214 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(7), zeal, shield_of_vengeance, chaotic_energy(2), legions_gaze(2), potion_of_the_old_war
0:05.969 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(7), zeal(2), shield_of_vengeance, chaotic_energy(2), legions_gaze(2), potion_of_the_old_war
0:06.725 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(7), zeal(3), shield_of_vengeance, chaotic_energy(3), legions_gaze(3), potion_of_the_old_war
0:07.479 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(3), legions_gaze(3), potion_of_the_old_war
0:08.234 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), legions_gaze(4), potion_of_the_old_war
0:09.134 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(4), legions_gaze(4), potion_of_the_old_war
0:09.888 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), legions_gaze(5), potion_of_the_old_war
0:10.728 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(5), legions_gaze(5), potion_of_the_old_war
0:11.481 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:11.581 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:12.515 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:12.615 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:13.563 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:13.563 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:14.317 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(6), legions_gaze(6), potion_of_the_old_war
0:15.071 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), legions_gaze(7), potion_of_the_old_war
0:15.826 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(7), legions_gaze(7), potion_of_the_old_war
0:16.581 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), legions_gaze(8), potion_of_the_old_war
0:17.335 Waiting 0.200 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), legions_gaze(8), potion_of_the_old_war
0:17.535 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(8), legions_gaze(8), potion_of_the_old_war
0:18.475 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), legions_gaze(9), potion_of_the_old_war
0:19.228 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(9), legions_gaze(9), potion_of_the_old_war
0:19.982 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10), potion_of_the_old_war
0:20.736 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10), potion_of_the_old_war
0:21.636 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10), potion_of_the_old_war
0:22.633 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10), potion_of_the_old_war
0:23.389 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10)
0:23.589 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10)
0:23.589 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10)
0:24.342 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(10), legions_gaze(10)
0:25.095 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11), legions_gaze(10)
0:25.850 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(11), legions_gaze(10)
0:26.790 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12), legions_gaze(10)
0:27.545 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, crusade(15), zeal(3), chaotic_energy(12), legions_gaze(10)
0:28.300 Waiting 0.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, raid_movement, crusade(15), zeal(3), chaotic_energy(13), legions_gaze(10)
0:29.200 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(13), legions_gaze(10)
0:29.200 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(13), legions_gaze(10)
0:30.110 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(13), legions_gaze(10)
0:31.019 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power bloodlust, zeal(3), chaotic_energy(13), legions_gaze(10)
0:31.928 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(14), legions_gaze(10)
0:32.837 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(14), legions_gaze(10)
0:33.746 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(15), legions_gaze(10)
0:34.654 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(15), legions_gaze(10)
0:35.563 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power bloodlust, zeal(3), chaotic_energy(15), legions_gaze(10)
0:36.473 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(16), legions_gaze(10)
0:37.382 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power bloodlust, zeal(3), chaotic_energy(16), legions_gaze(10)
0:38.288 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power bloodlust, zeal(3), chaotic_energy(17), legions_gaze(10)
0:39.199 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power bloodlust, zeal(3), chaotic_energy(17), legions_gaze(10)
0:40.108 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(18), legions_gaze(10)
0:40.108 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power bloodlust, zeal(3), chaotic_energy(18), legions_gaze(10)
0:41.018 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(18), legions_gaze(10)
0:42.199 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(18), legions_gaze(10)
0:43.381 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(19), legions_gaze(10)
0:44.563 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(19), legions_gaze(10)
0:45.163 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(19), legions_gaze(10)
0:45.163 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(19), legions_gaze(10)
0:46.345 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(19), legions_gaze(10)
0:47.628 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(19), legions_gaze(10)
0:48.810 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:49.990 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:50.004 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
0:51.185 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
0:51.385 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
0:52.802 Waiting 0.800 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
0:53.602 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:53.602 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:54.783 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:55.963 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:57.144 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:58.327 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
0:59.508 Waiting 1.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:00.808 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
1:02.222 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:02.222 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:03.404 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:04.585 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:05.766 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:06.948 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:08.128 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:09.308 Waiting 0.700 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:10.008 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:11.191 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:12.373 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:13.555 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:14.736 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:15.917 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:17.101 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
1:17.201 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:17.201 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:17.201 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:18.382 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:19.562 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
1:20.744 Waiting 0.800 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
1:21.544 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
1:22.973 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
1:23.573 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:23.573 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20)
1:24.755 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20)
1:25.936 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20)
1:27.116 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze
1:28.298 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze
1:29.478 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
1:30.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:30.660 Waiting 0.400 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:31.060 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:32.394 Waiting 0.400 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:32.794 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:34.179 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:34.179 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:35.361 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:36.541 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(2)
1:37.722 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(3)
1:38.904 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(3)
1:40.084 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(4)
1:41.264 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(4)
1:42.446 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(4)
1:43.627 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(5)
1:44.810 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(5)
1:45.992 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:47.174 Waiting 2.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:49.174 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:49.174 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:50.355 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(6)
1:51.535 Waiting 0.100 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(6)
1:51.635 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(6)
1:53.048 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(6)
1:54.231 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:54.231 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:54.231 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:55.413 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
1:56.594 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20)
1:57.778 Waiting 0.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze
1:58.378 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze
1:59.780 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze
2:00.962 Waiting 0.100 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
2:01.062 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
2:02.468 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
2:03.648 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
2:04.829 Waiting 0.400 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(3)
2:05.229 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
2:05.229 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
2:05.729 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
2:07.160 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
2:08.342 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
2:09.523 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
2:09.523 potion Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), legions_gaze(4)
2:09.523 Waiting 0.500 sec 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), legions_gaze(4), potion_of_the_old_war
2:10.023 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), legions_gaze(4), potion_of_the_old_war
2:11.164 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(5), potion_of_the_old_war
2:12.200 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(5), potion_of_the_old_war
2:13.236 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(5), potion_of_the_old_war
2:14.274 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(6), potion_of_the_old_war
2:15.312 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(6), potion_of_the_old_war
2:16.263 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7), potion_of_the_old_war
2:17.285 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7), potion_of_the_old_war
2:18.234 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:19.271 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:20.311 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:21.338 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:21.338 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:22.214 Waiting 0.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:22.314 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:23.345 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), legions_gaze(8), potion_of_the_old_war
2:24.345 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), chaotic_energy(20), legions_gaze(9), potion_of_the_old_war
2:25.312 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), chaotic_energy(20), legions_gaze(9), potion_of_the_old_war
2:26.125 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:26.901 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:27.201 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:28.217 Waiting 0.300 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:28.517 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:29.503 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:30.280 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:31.054 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:31.654 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:32.600 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:32.600 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:33.377 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:34.397 Waiting 0.300 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10), potion_of_the_old_war
2:34.697 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
2:35.699 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
2:36.475 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
2:37.251 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:37.251 Waiting 0.600 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:37.851 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:39.203 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:40.387 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:41.567 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:42.748 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:43.932 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:45.115 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:46.297 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:47.477 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:48.659 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:49.840 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:51.022 Waiting 0.900 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
2:51.922 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
2:52.004 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
2:53.351 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:53.351 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:54.533 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:55.713 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:56.895 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:57.895 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
2:59.265 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:00.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:00.446 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:01.629 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:02.810 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:03.992 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:05.175 Waiting 0.900 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:06.075 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:07.489 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:08.670 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:09.850 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:09.850 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:09.850 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:11.031 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:12.212 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:13.395 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:14.578 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
3:15.759 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:16.941 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:18.123 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:19.305 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:20.485 Waiting 2.100 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:22.585 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:23.995 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:23.995 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:25.176 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:25.176 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:26.365 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:27.548 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:27.548 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:28.730 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:29.912 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:31.094 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:32.278 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:33.178 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:34.610 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:35.791 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:36.973 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:38.156 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:39.338 Waiting 1.900 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:41.238 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:41.238 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:41.438 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:42.854 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:44.037 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:45.218 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:46.399 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:46.399 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:47.581 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:48.764 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:49.945 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:51.126 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:52.308 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:53.489 Waiting 0.100 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:53.589 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:53.589 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:54.771 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:55.952 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:57.133 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
3:57.233 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:57.233 Waiting 0.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:57.933 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
3:59.357 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:00.551 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze
4:01.733 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze
4:02.914 Waiting 1.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
4:04.014 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
4:05.373 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(2)
4:06.554 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
4:07.736 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(3)
4:08.919 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
4:08.919 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
4:10.102 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
4:11.282 Waiting 1.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(4)
4:13.182 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(5)
4:13.182 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(5)
4:14.364 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(5)
4:15.546 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(5)
4:15.646 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(5)
4:17.020 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
4:18.201 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(6)
4:19.381 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(7)
4:19.381 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), legions_gaze(7)
4:20.522 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20), legions_gaze(7)
4:21.559 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, crusade(4), zeal(3), chaotic_energy(20), legions_gaze(7)
4:22.596 Waiting 1.000 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:23.596 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:23.596 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:24.545 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:24.545 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:25.496 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(7)
4:26.446 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(8)
4:27.395 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(8)
4:28.346 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8)
4:29.221 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8)
4:29.221 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(8)
4:30.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(8)
4:30.148 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(10), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(8)
4:31.023 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(8)
4:31.923 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(9)
4:32.926 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(9)
4:33.737 Waiting 0.500 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:34.237 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:35.265 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(13), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:36.078 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:36.857 Waiting 0.700 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:37.557 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:38.559 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:39.362 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:40.139 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:40.916 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:41.693 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:42.469 Waiting 0.800 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:43.269 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:44.232 Waiting 0.300 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:44.532 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, crusade(15), zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
4:45.539 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
4:45.539 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
4:46.320 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(15), zeal(3), chaotic_energy(20), legions_gaze(10)
4:47.096 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:48.277 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:49.460 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:49.460 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:50.641 Waiting 0.100 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
4:50.741 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
4:52.131 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
4:53.313 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
4:54.494 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:54.494 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:55.676 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:56.858 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:58.040 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
4:59.222 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:00.403 Waiting 0.800 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
5:01.203 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:01.203 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:01.303 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:02.732 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:03.912 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:05.093 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:06.274 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:07.274 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:08.645 divine_storm Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:09.826 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:11.008 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:12.188 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:13.369 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:14.550 Waiting 0.900 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:15.450 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:16.869 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
5:18.050 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:18.050 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:19.233 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:20.416 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:21.609 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:22.789 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:23.970 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:25.153 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:26.334 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:27.516 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:28.698 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:28.898 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:30.254 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:30.254 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:31.433 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:32.615 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
5:33.215 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:33.215 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:34.567 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:35.756 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:36.937 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:38.118 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:39.301 Waiting 0.200 sec 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:39.501 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:40.857 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:42.039 Waiting 0.600 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:42.639 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:44.002 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:45.184 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:46.365 Waiting 0.900 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:47.265 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:48.695 Waiting 0.200 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
5:48.895 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
5:50.276 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:50.276 Waiting 0.600 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:50.876 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:52.244 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:53.426 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:54.607 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:55.789 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:56.970 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:58.151 Waiting 0.200 sec 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:58.351 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
5:59.696 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:00.000 shield_of_vengeance Healing_Target 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:00.878 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:02.059 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:03.240 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:04.421 Waiting 0.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:05.221 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:05.221 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:06.403 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:07.587 Waiting 0.100 sec 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:07.687 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:09.115 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:10.301 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:11.483 rebuke Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:11.483 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:12.665 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:13.846 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), shield_of_vengeance, chaotic_energy(20), legions_gaze(10)
6:15.025 Waiting 1.800 sec 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:16.825 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:18.164 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:19.346 execution_sentence Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:20.527 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power raid_movement, zeal(3), chaotic_energy(20), legions_gaze(10)
6:21.710 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:21.710 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:22.891 Waiting 1.000 sec 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:23.891 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:25.229 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:26.410 wake_of_ashes Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:27.591 crusade Healing_Target 220000.0/220000: 100% mana | 5.0/5: 100% holy_power zeal(3), chaotic_energy(20), legions_gaze(10)
6:27.591 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/5: 100% holy_power crusade, zeal(3), chaotic_energy(20), legions_gaze(10)
6:28.733 blade_of_justice Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(10)
6:29.769 judgment Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(10)
6:30.983 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 4.0/5: 80% holy_power crusade(4), zeal(3), chaotic_energy(20), legions_gaze(10)
6:32.019 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 1.0/5: 20% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(10)
6:32.970 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 2.0/5: 40% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(10)
6:33.919 templars_verdict Fluffy_Pillow 220000.0/220000: 100% mana | 3.0/5: 60% holy_power crusade(7), zeal(3), chaotic_energy(20), legions_gaze(10)
6:34.869 zeal Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/5: 0% holy_power crusade(10), zeal(3), chaotic_energy(20), legions_gaze(10)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 26912 25205 13775 (12011)
Agility 3198 3198 0
Stamina 36509 36509 22080
Intellect 7326 7326 0
Spirit 0 0 0
Health 2190540 2190540 0
Mana 220000 220000 0
Holy Power 5 5 0
Spell Power 26912 25205 0
Crit 22.59% 22.59% 6156
Haste 27.38% 26.22% 8523
Damage / Heal Versatility 0.00% 0.00% 0
Attack Power 26912 25205 0
Mastery 26.71% 26.71% 3432
Armor 4190 4190 4190
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 862.00
Local Head Venom-Fanged Barbute
ilevel: 865, stats: { 573 Armor, +2237 Sta, +1491 StrInt, +779 Haste, +601 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 860, stats: { +1201 Sta, +1252 Crit, +653 Haste }, enchant: mark_of_the_hidden_satyr
Local Shoulders Nightsfall Shoulderplates
ilevel: 870, stats: { 535 Armor, +1172 StrInt, +1758 Sta, +618 Haste, +437 Mastery }
Local Chest Breastplate of Preservation
ilevel: 860, stats: { 698 Armor, +1424 StrInt, +2136 Sta, +939 Crit, +416 Mastery }
Local Waist Chain of Thrayn
ilevel: 895, stats: { 424 Armor, +2219 Sta, +1479 StrInt, +413 Crit, +745 Haste }
Local Legs Storm-Battered Legplates
ilevel: 850, stats: { 597 Armor, +1945 Sta, +1297 StrInt, +764 Haste, +540 Mastery }
Local Feet Warboots of Smoldering Fury
ilevel: 860, stats: { 480 Armor, +1601 Sta, +1068 StrInt, +661 Haste, +355 Mastery }
Local Wrists Wristclamps of Mad Dreams
ilevel: 870, stats: { 312 Armor, +1319 Sta, +879 StrInt, +481 Crit, +311 Haste }
Local Hands Tarnished Dreamkeeper's Gauntlets
ilevel: 865, stats: { 441 Armor, +1678 Sta, +1119 StrInt, +673 Haste, +362 Mastery }
Local Finger1 An'she's Band
ilevel: 845, stats: { +1045 Sta, +1029 Haste, +772 Crit }
Local Finger2 Twice-Warped Azsharan Signet
ilevel: 860, stats: { +1201 Sta, +1307 Crit, +599 Haste }, gems: { +150 Haste }
Local Trinket1 Chaos Talisman
ilevel: 840, stats: { +898 Haste }
Local Trinket2 Eye of Command
ilevel: 860, stats: { +1353 StrAgi }
Local Back Evergreen Vinewrap Drape
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +493 Haste, +241 Crit }, gems: { +150 Haste }
Local Main Hand Ashbringer
ilevel: 883, weapon: { 9126 - 13690, 3.6 }, stats: { +1764 Str, +2646 Sta, +751 Crit, +721 Mastery }, relics: { +45 ilevels, +48 ilevels, +40 ilevels }

Talents

Level
15 Final Verdict (Retribution Paladin) Execution Sentence (Retribution Paladin) Consecration (Retribution Paladin)
30 The Fires of Justice (Retribution Paladin) Zeal (Retribution Paladin) Greater Judgment (Retribution Paladin)
45 Fist of Justice Repentance Blinding Light
60 Virtue's Blade (Retribution Paladin) Blade of Wrath (Retribution Paladin) Divine Hammer (Retribution Paladin)
75 Justicar's Vengeance (Retribution Paladin) Eye for an Eye (Retribution Paladin) Word of Glory (Retribution Paladin)
90 Divine Intervention (Retribution Paladin) Cavalier (Retribution Paladin) Seal of Light (Retribution Paladin)
100 Divine Purpose (Retribution Paladin) Crusade (Retribution Paladin) Holy Wrath (Retribution Paladin)

Profile

paladin="Zipi"
origin="https://us.api.battle.net/wow/character/thrall/Zipi/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/146/160036754-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=mining=714/herbalism=673
talents=2231223
artifact=2:0:0:0:0:40:1:41:3:42:3:43:3:47:3:50:3:51:3:53:3:350:1:351:1:353:1:1275:1
spec=retribution

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_countless_armies
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/greater_blessing_of_might
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war

# Executed every time the actor is available.
actions=auto_attack
actions+=/rebuke
actions+=/potion,name=old_war,if=(buff.bloodlust.react|buff.avenging_wrath.up|buff.crusade.up|target.time_to_die<=40)
actions+=/holy_wrath
actions+=/avenging_wrath
actions+=/shield_of_vengeance
actions+=/crusade,if=holy_power>=5
actions+=/wake_of_ashes,if=holy_power>=0&time<2
actions+=/execution_sentence,if=spell_targets.divine_storm<=3&(cooldown.judgment.remains<gcd*4.5|debuff.judgment.remains>gcd*4.67)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*2)
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent,if=holy_power<5
actions+=/call_action_list,name=VB,if=talent.virtues_blade.enabled
actions+=/call_action_list,name=DH,if=talent.divine_hammer.enabled

actions.DH=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.DH+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.DH+=/wake_of_ashes,if=holy_power<=1
actions.DH+=/zeal,if=charges=2&holy_power<=4
actions.DH+=/crusader_strike,if=charges=2&holy_power<=4
actions.DH+=/divine_hammer,if=holy_power<=3
actions.DH+=/judgment
actions.DH+=/consecration
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.DH+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.DH+=/templars_verdict,if=debuff.judgment.up&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*6)
actions.DH+=/zeal,if=holy_power<=4
actions.DH+=/crusader_strike,if=holy_power<=4

actions.VB=divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2&!equipped.whisper_of_the_nathrezim
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.up&buff.divine_purpose.remains<gcd*2
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=5&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&holy_power>=3&buff.divine_purpose.up&cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(cooldown.wake_of_ashes.remains<gcd*2&artifact.wake_of_ashes.enabled|buff.whisper_of_the_nathrezim.up&buff.whisper_of_the_nathrezim.remains<gcd)&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/wake_of_ashes,if=holy_power=0|holy_power=1&cooldown.blade_of_justice.remains>gcd|holy_power=2&(cooldown.zeal.charges_fractional<=0.34|cooldown.crusader_strike.charges_fractional<=0.34)
actions.VB+=/zeal,if=charges=2&holy_power<=4
actions.VB+=/crusader_strike,if=charges=2&holy_power<=4
actions.VB+=/blade_of_justice,if=holy_power<=2|(holy_power<=3&(cooldown.zeal.charges_fractional<=1.34|cooldown.crusader_strike.charges_fractional<=1.34))
actions.VB+=/judgment,if=holy_power>=3|((cooldown.zeal.charges_fractional<=1.67|cooldown.crusader_strike.charges_fractional<=1.67)&cooldown.blade_of_justice.remains>gcd)|(talent.greater_judgment.enabled&target.health.pct>50)
actions.VB+=/consecration
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.divine_purpose.react
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/divine_storm,if=debuff.judgment.up&spell_targets.divine_storm>=2&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/justicars_vengeance,if=debuff.judgment.up&buff.divine_purpose.react&!equipped.whisper_of_the_nathrezim
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.divine_purpose.react
actions.VB+=/templars_verdict,if=debuff.judgment.up&buff.the_fires_of_justice.react&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*3)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=4&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*4)
actions.VB+=/zeal,if=holy_power<=4
actions.VB+=/crusader_strike,if=holy_power<=4
actions.VB+=/divine_storm,if=debuff.judgment.up&holy_power>=3&spell_targets.divine_storm>=2&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)
actions.VB+=/templars_verdict,if=debuff.judgment.up&holy_power>=3&(!talent.crusade.enabled|cooldown.crusade.remains>gcd*5)

head=venomfanged_barbute,id=139229,bonus_id=1805/1487
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/1482/3336,enchant=mark_of_the_hidden_satyr
shoulders=nightsfall_shoulderplates,id=139060,bonus_id=3432/1532/3337
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1808/1472,gems=150haste
chest=breastplate_of_preservation,id=134500,bonus_id=3412/1512/3336
wrists=wristclamps_of_mad_dreams,id=139235,bonus_id=1807/1492/3337
hands=tarnished_dreamkeepers_gauntlets,id=141695,bonus_id=1805/1487
waist=chain_of_thrayn,id=137086,bonus_id=1811
legs=stormbattered_legplates,id=139230,bonus_id=1807/1472
feet=warboots_of_smoldering_fury,id=141437,bonus_id=1472
finger1=anshes_band,id=139103,bonus_id=3432/1507/3336
finger2=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1808/1482/3336,gems=150haste
trinket1=chaos_talisman,id=137459,bonus_id=1727/1492/1813
trinket2=eye_of_command,id=142167,bonus_id=3453/1472
main_hand=ashbringer,id=120978,bonus_id=737,gem_id=141276/141522/143686/0,relic_id=3397:1517:3337/1477:3336/3473:1502:1674/0

# Gear Summary
# gear_ilvl=862.20
# gear_strength=13775
# gear_stamina=22080
# gear_crit_rating=6156
# gear_haste_rating=8523
# gear_mastery_rating=3432
# gear_armor=4190

Faelik

Faelik : 442552 dps, 298655 dps to main target

  • Race: Undead
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
442552.1 442552.1 416.5 / 0.094% 82285.3 / 18.6% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 1.11% 56.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Faelik/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Void Lord (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Power Infusion (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • alchemy: 650
  • herbalism: 800
Scale Factors for Faelik Damage Per Second
Crit Int Mastery Haste Vers
Scale Factors 15.21 13.59 13.31 12.32 10.96
Normalized 1.12 1.00 0.98 0.91 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.52 0.53 0.53 0.51 0.52
Gear Ranking
Optimizers
Ranking
  • Crit > Int ~= Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.59, CritRating=15.21, HasteRating=12.32, MasteryRating=13.31, Versatility=10.96 )

Scale Factors for other metrics

Scale Factors for Faelik Damage Per Second
Crit Int Mastery Haste Vers
Scale Factors 15.21 13.59 13.31 12.32 10.96
Normalized 1.12 1.00 0.98 0.91 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.52 0.53 0.53 0.51 0.52
Gear Ranking
Optimizers
Ranking
  • Crit > Int ~= Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.59, CritRating=15.21, HasteRating=12.32, MasteryRating=13.31, Versatility=10.96 )
Scale Factors for Faelik Priority Target Damage Per Second
Crit Int Haste Mastery Vers
Scale Factors 11.02 9.05 8.55 8.39 7.37
Normalized 1.22 1.00 0.95 0.93 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.17 0.17 0.16 0.17 0.17
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Haste ~= Mastery > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=9.05, CritRating=11.02, HasteRating=8.55, MasteryRating=8.39, Versatility=7.37 )
Scale Factors for Faelik Damage Per Second (Effective)
Crit Int Mastery Haste Vers
Scale Factors 15.21 13.59 13.31 12.32 10.96
Normalized 1.12 1.00 0.98 0.91 0.81
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Crit > Int > Mastery > Haste > Vers
Pawn string ( Pawn: v1: "Faelik": Intellect=13.59, CritRating=15.21, HasteRating=12.32, MasteryRating=13.31, Versatility=10.96 )
Scale Factors for Faelik Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for Faelik Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )
Scale Factors for FaelikTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Faelik": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Faelik 442552
Deadly Grace 9595 2.1% 32.5 12.65sec 116635 0 Direct 32.4 96654 193415 116763 20.8%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 32.48 32.45 0.00 0.00 0.0000 0.0000 3788667.00 3788667.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.70 79.21% 96653.59 87722 105266 96639.11 91231 101757 2484259 2484259 0.00
crit 6.74 20.79% 193414.84 175443 210532 193231.70 0 210532 1304408 1304408 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 32038 7.3% 61.4 6.45sec 208800 231030 Direct 62.4 170067 339895 205454 20.8%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 61.43 62.43 0.00 0.00 0.9038 0.0000 12826570.93 12826570.93 0.00 231030.29 231030.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 49.42 79.16% 170066.73 122821 191600 170058.45 159597 178827 8404840 8404840 0.00
crit 13.01 20.84% 339895.15 245642 383201 339901.17 245642 383201 4421731 4421731 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 16284 3.8% 58.8 6.85sec 113515 80904 Periodic 164.2 33642 67263 40633 20.8% 18.0%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 58.78 0.00 164.21 164.21 1.4031 0.4385 6672131.02 6672131.02 0.00 80903.73 80903.73
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 130.1 79.21% 33641.54 24511 38322 33589.99 31005 35641 4375496 4375496 0.00
crit 34.1 20.79% 67262.99 49131 76644 67160.39 57778 75026 2296635 2296635 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 42497 9.5% 35.1 8.08sec 478106 346094 Periodic 500.1 27761 55512 33536 20.8% 9.8%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.08 0.00 88.13 500.08 1.3815 0.4466 16770688.53 16770688.53 0.00 346094.24 346094.24
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 396.0 79.19% 27761.24 20098 31353 27774.05 25275 29247 10993614 10993614 0.00
crit 104.1 20.81% 55512.40 40196 62706 55538.60 48987 59674 5777075 5777075 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Plague Swarm 13354 3.0% 27.3 14.45sec 196183 0 Periodic 108.6 40773 81568 49264 20.8% 53.3%

Stats details: plague_swarm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.26 0.00 108.56 108.56 0.0000 1.9653 5347942.64 5347942.64 0.00 25067.58 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 86.0 79.19% 40772.87 18 43925 40787.79 38476 43363 3504923 3504923 0.00
crit 22.6 20.81% 81567.57 44 87850 81589.87 66821 87850 1843020 1843020 0.00
 
 

Action details: plague_swarm

Static Values
  • id:221812
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:221812
  • name:Plague Swarm
  • school:nature
  • tooltip:Suffering $w1 Nature damage every $t1 sec.
  • description:{$@spelldesc221811=Your damaging spells have a chance for a swarm of carrion insects to engulf your target, dealing $221812o1 Nature damage over {$221812d=10 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:33037.00
  • dot_duration:10.00
  • base_tick_time:2.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Shadow Word: Death 4470 1.0% 8.1 9.95sec 221056 252265 Direct 8.1 182876 365948 221067 20.9%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.06 8.06 0.00 0.00 0.8763 0.0000 1780742.00 1780742.00 0.00 252265.48 252265.48
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.38 79.14% 182875.74 145153 188699 182882.81 145153 188699 1165936 1165936 0.00
crit 1.68 20.86% 365948.42 290306 377398 308903.42 0 377398 614806 614806 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 62930 (76796) 14.2% (17.4%) 52.1 7.51sec 588083 673861 Direct 52.1 39866 79767 48183 20.8%  
Periodic 382.0 48994 98017 59212 20.8% 106.9%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 52.06 52.06 382.01 382.01 0.8727 1.1210 25128022.02 25128022.02 0.00 64637.36 673861.47
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 41.21 79.16% 39865.72 25517 74836 39905.04 33647 45913 1642771 1642771 0.00
crit 10.85 20.84% 79767.04 51034 148079 79866.25 51034 128972 865640 865640 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 302.4 79.16% 48993.96 155 85631 49029.78 46269 52207 14814782 14814782 0.00
crit 79.6 20.84% 98017.04 2732 169515 98040.34 86134 110617 7804829 7804829 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Sphere of Insanity 13866 3.1% 322.2 1.20sec 17033 0 Direct 422.5 12988 0 12988 0.0%  

Stats details: sphere_of_insanity

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 322.17 422.52 0.00 0.00 0.0000 0.0000 5487526.00 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 422.52 100.00% 12987.54 7885 38083 12998.72 11019 15663 5487526 0 0.00
 
 

Action details: sphere_of_insanity

Static Values
  • id:194182
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:194182
  • name:Sphere of Insanity
  • school:physical
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
 
Shadowy Apparitions 13989 3.2% 162.5 2.43sec 34301 0 Direct 161.3 28612 57220 34555 20.8%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 162.49 161.30 0.00 0.00 0.0000 0.0000 5573663.09 5573663.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 127.79 79.22% 28611.78 20470 31933 28616.47 27169 29848 3656159 3656159 0.00
crit 33.51 20.78% 57219.74 40940 63867 57231.92 51285 62658 1917504 1917504 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Touch of the Grave 3275 0.7% 25.4 16.02sec 51631 0 Direct 25.4 51631 0 51631 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 25.40 25.40 0.00 0.00 0.0000 0.0000 1311184.59 1311184.59 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 25.40 100.00% 51630.88 37218 58061 51637.03 49077 55398 1311185 1311185 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 135949 30.6% 41.1 7.40sec 1311988 1527927 Periodic 530.0 84266 168598 101850 20.9% 215.9%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 41.14 0.00 529.98 529.98 0.8587 1.6316 53978603.95 53978603.95 0.00 59974.09 1527926.97
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 419.5 79.15% 84266.03 87 146504 84275.91 74440 90260 35347533 35347533 0.00
crit 110.5 20.85% 168597.97 748 293009 168596.56 145235 185779 18631071 18631071 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 56857 12.9% 104.2 3.69sec 218225 253921 Direct 103.9 181067 362135 218847 20.9%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 104.19 103.89 0.00 0.00 0.8594 0.0000 22735863.34 22735863.34 0.00 253921.35 253921.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 82.21 79.13% 181067.08 121300 189229 181083.69 176888 185049 14885826 14885826 0.00
crit 21.68 20.87% 362134.78 242601 378457 362176.73 336406 378457 7850038 7850038 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 9155 2.1% 10.4 39.10sec 350109 0 Direct 50.0 60193 120379 72746 20.9%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.39 49.99 0.00 0.00 0.0000 0.0000 3636837.72 3636837.72 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 39.57 79.14% 60192.96 55829 66995 60202.54 56325 65184 2381588 2381588 0.00
crit 10.43 20.86% 120378.86 111658 133989 120391.35 111658 133989 1255250 1255250 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 14283 3.2% 6.8 61.29sec 835737 265339 Periodic 40.4 116964 234210 141309 20.8% 4.9%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.84 0.00 40.45 40.45 3.1497 0.4815 5715674.24 5715674.24 0.00 265339.32 265339.32
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.1 79.24% 116964.24 379 127735 117072.80 104326 127735 3748699 3748699 0.00
crit 8.4 20.76% 234210.05 1366 255471 234522.63 0 255471 1966975 1966975 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
pet - shadowfiend 107860 / 7382
melee 107860 1.7% 35.4 8.03sec 83432 120300 Direct 35.4 69069 138133 83432 20.8%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 35.43 35.43 0.00 0.00 0.6935 0.0000 2956379.45 2956379.45 0.00 120300.28 120300.28
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 28.07 79.20% 69068.92 61593 70832 69067.05 67571 70502 1938463 1938463 0.00
crit 7.37 20.80% 138132.61 123185 141663 137972.32 0 141663 1017916 1017916 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 30476 / 5716
Mind Flay (_void_tendril) 30476 (33505) 1.3% (2.0%) 9.2 41.48sec 386170 61249 Periodic 58.2 32850 65701 39679 20.8% 14.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.24 0.00 58.23 58.23 6.3049 1.0000 2310560.60 2310560.60 0.00 61249.13 61249.13
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.1 79.21% 32850.45 32850 32850 32850.45 32850 32850 1515290 1515290 0.00
crit 12.1 20.79% 65700.90 65701 65701 65700.90 65701 65701 795271 795271 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 28451 0.3% 2.5 66.11sec 193054 39606 Periodic 12.0 32850 65701 39604 20.6% 3.0%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.45 0.00 11.96 11.96 4.8745 1.0000 473489.11 473489.11 0.00 39605.95 39605.95
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.5 79.44% 32850.45 32850 32850 32718.67 0 32850 311986 311986 0.00
crit 2.5 20.56% 65700.90 65701 65701 57175.87 0 65701 161503 161503 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 29407 0.2% 1.5 20.66sec 199645 39876 Periodic 7.5 32850 65701 39876 21.4% 1.9%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.50 0.00 7.50 7.50 5.0067 1.0000 299267.61 299267.61 0.00 39875.76 39875.76
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 5.9 78.61% 32850.45 32850 32850 32653.35 0 32850 193818 193818 0.00
crit 1.6 21.39% 65700.90 65701 65701 53217.73 0 65701 105450 105450 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 29852 0.2% 1.3 5.32sec 212589 38657 Periodic 7.4 32850 65701 38653 17.7% 1.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.35 0.00 7.40 7.40 5.5000 1.0000 286177.97 286177.97 0.00 38657.03 38657.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.1 82.34% 32850.45 32850 32850 32850.45 32850 32850 200261 200261 0.00
crit 1.3 17.66% 65700.90 65701 65701 48012.20 0 65701 85917 85917 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 19710 0.1% 2.0 0.00sec 98551 39421 Periodic 5.0 32850 65701 39421 20.0% 1.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 5.00 5.00 2.5000 1.0000 197102.71 197102.71 0.00 39420.54 39420.54
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.0 80.00% 32850.45 32850 32850 32850.45 32850 32850 131402 131402 0.00
crit 1.0 20.00% 65700.90 65701 65701 65700.90 65701 65701 65701 65701 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Faelik
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Faelik
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Power Infusion 3.6 120.92sec

Stats details: power_infusion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: power_infusion

Static Values
  • id:10060
  • school:holy
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.insanity_drain_stacks.stack>=85
Spelldata
  • id:10060
  • name:Power Infusion
  • school:holy
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
 
Shadowfiend 2.3 198.93sec

Stats details: shadowfiend

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.33 0.00 0.00 0.00 0.8653 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowfiend

Static Values
  • id:34433
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:34433
  • name:Shadowfiend
  • school:shadow
  • tooltip:
  • description:Summons a shadowy fiend to attack the target for {$d=12 seconds}.
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - shadowfiend
Shadowcrawl 4.6 74.83sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.63 0.00 0.00 0.00 0.8555 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 9.84% 0.0(0.0) 1.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 10.4 271.7 39.2sec 39.2sec 74.07% 74.07% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.18%
  • insanity_drain_stacks_2:2.58%
  • insanity_drain_stacks_3:2.63%
  • insanity_drain_stacks_4:2.62%
  • insanity_drain_stacks_5:2.56%
  • insanity_drain_stacks_6:2.63%
  • insanity_drain_stacks_7:2.58%
  • insanity_drain_stacks_8:2.57%
  • insanity_drain_stacks_9:2.64%
  • insanity_drain_stacks_10:2.74%
  • insanity_drain_stacks_11:2.60%
  • insanity_drain_stacks_12:2.97%
  • insanity_drain_stacks_13:3.16%
  • insanity_drain_stacks_14:2.76%
  • insanity_drain_stacks_15:3.12%
  • insanity_drain_stacks_16:2.72%
  • insanity_drain_stacks_17:2.63%
  • insanity_drain_stacks_18:2.77%
  • insanity_drain_stacks_19:2.55%
  • insanity_drain_stacks_20:2.71%
  • insanity_drain_stacks_21:2.61%
  • insanity_drain_stacks_22:2.17%
  • insanity_drain_stacks_23:2.00%
  • insanity_drain_stacks_24:1.62%
  • insanity_drain_stacks_25:1.32%
  • insanity_drain_stacks_26:1.10%
  • insanity_drain_stacks_27:0.93%
  • insanity_drain_stacks_28:0.84%
  • insanity_drain_stacks_29:0.81%
  • insanity_drain_stacks_30:0.79%
  • insanity_drain_stacks_31:0.78%
  • insanity_drain_stacks_32:0.76%
  • insanity_drain_stacks_33:0.70%
  • insanity_drain_stacks_34:0.59%
  • insanity_drain_stacks_35:0.55%
  • insanity_drain_stacks_36:0.53%
  • insanity_drain_stacks_37:0.43%
  • insanity_drain_stacks_38:0.35%
  • insanity_drain_stacks_39:0.25%
  • insanity_drain_stacks_40:0.14%
  • insanity_drain_stacks_41:0.06%
  • insanity_drain_stacks_42:0.02%
  • insanity_drain_stacks_43:0.00%
  • insanity_drain_stacks_44:0.00%
  • insanity_drain_stacks_45:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 10.4 0.0 37.3sec 37.3sec 41.21% 90.20% 0.0(0.0) 9.2

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_17:0.00%
  • lingering_insanity_18:0.00%
  • lingering_insanity_19:0.09%
  • lingering_insanity_20:0.82%
  • lingering_insanity_21:1.71%
  • lingering_insanity_22:5.56%
  • lingering_insanity_23:2.62%
  • lingering_insanity_24:1.78%
  • lingering_insanity_25:2.16%
  • lingering_insanity_26:1.04%
  • lingering_insanity_27:2.68%
  • lingering_insanity_28:2.08%
  • lingering_insanity_29:2.60%
  • lingering_insanity_30:1.74%
  • lingering_insanity_31:0.96%
  • lingering_insanity_32:0.67%
  • lingering_insanity_33:0.30%
  • lingering_insanity_34:0.32%
  • lingering_insanity_35:0.49%
  • lingering_insanity_36:1.98%
  • lingering_insanity_37:2.78%
  • lingering_insanity_38:0.68%
  • lingering_insanity_39:0.35%
  • lingering_insanity_40:0.40%
  • lingering_insanity_41:0.87%
  • lingering_insanity_42:1.24%
  • lingering_insanity_43:2.12%
  • lingering_insanity_44:1.71%
  • lingering_insanity_45:0.96%
  • lingering_insanity_46:0.44%
  • lingering_insanity_47:0.05%
  • lingering_insanity_48:0.01%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 15.2 19.9 19.0sec 8.1sec 28.88% 28.88% 0.0(0.0) 15.2

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:28.88%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.1sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
Power Infusion 3.6 0.0 120.9sec 120.9sec 17.60% 17.60% 0.0(0.0) 3.5

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_power_infusion
  • max_stacks:1
  • duration:20.00
  • cooldown:120.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • power_infusion_1:17.60%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:10060
  • name:Power Infusion
  • tooltip:Haste increased by {$s1=25}% and mana cost of spells reduced by {$s2=20}%.
  • description:Infuses you with power for {$d=20 seconds}, increasing haste by {$s1=25}%{$?s185916=false}[ and increasing Insanity generation by {$s3=25}%][ and reducing the mana cost of all spells by {$s2=20}%].
  • max_stacks:0
  • duration:20.00
  • cooldown:120.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Sphere of Insanity 10.4 0.0 39.2sec 39.2sec 74.07% 76.53% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_sphere_of_insanity
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.00

Stack Uptimes

  • sphere_of_insanity_1:74.07%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194182
  • name:Sphere of Insanity
  • tooltip:
  • description:{$@spelldesc194179=The Sphere of Insanity manifests for the duration of Voidform. Your Void Bolts, Mind Blasts, and {$?s73510=false}[Mind Spikes][Mind Flays] cause the sphere to duplicate {$194182s3=5}% their damage to all enemies affected by your Shadow Word: Pain.}
  • max_stacks:0
  • duration:120.00
  • cooldown:0.00
  • default_chance:0.00%
Twist of Fate 8.4 963.3 29.7sec 0.4sec 66.88% 66.88% 963.3(963.3) 7.4

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:66.88%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.8 0.0 61.3sec 61.3sec 5.12% 5.12% 0.0(0.0) 3.7

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:5.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 10.4 0.0 39.2sec 39.2sec 74.07% 76.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.59%
  • voidform_2:2.58%
  • voidform_3:2.58%
  • voidform_4:2.57%
  • voidform_5:2.56%
  • voidform_6:2.56%
  • voidform_7:2.55%
  • voidform_8:2.54%
  • voidform_9:2.54%
  • voidform_10:2.53%
  • voidform_11:2.52%
  • voidform_12:2.52%
  • voidform_13:2.51%
  • voidform_14:2.51%
  • voidform_15:2.50%
  • voidform_16:2.49%
  • voidform_17:2.49%
  • voidform_18:2.48%
  • voidform_19:2.47%
  • voidform_20:2.45%
  • voidform_21:2.37%
  • voidform_22:2.14%
  • voidform_23:1.86%
  • voidform_24:1.75%
  • voidform_25:1.61%
  • voidform_26:1.52%
  • voidform_27:1.40%
  • voidform_28:1.24%
  • voidform_29:1.09%
  • voidform_30:0.95%
  • voidform_31:0.87%
  • voidform_32:0.82%
  • voidform_33:0.79%
  • voidform_34:0.77%
  • voidform_35:0.75%
  • voidform_36:0.69%
  • voidform_37:0.52%
  • voidform_38:0.44%
  • voidform_39:0.42%
  • voidform_40:0.40%
  • voidform_41:0.37%
  • voidform_42:0.31%
  • voidform_43:0.23%
  • voidform_44:0.12%
  • voidform_45:0.05%
  • voidform_46:0.01%
  • voidform_47:0.00%
  • voidform_48:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
shadowfiend: raid_movement 0.4 0.0 0.0sec 0.0sec 5.33% 5.33% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:5.33%

Trigger Attempt Success

  • trigger_pct:40.44%
shadowfiend: Shadowcrawl 4.6 0.0 74.6sec 74.6sec 83.43% 80.90% 0.0(0.0) 4.6

Buff details

  • buff initial source:Faelik_shadowfiend
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:83.43%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
void_tendril: raid_movement 4.7 0.0 59.0sec 59.0sec 15.66% 15.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:15.66%

Trigger Attempt Success

  • trigger_pct:100.00%
void_tendril: raid_movement 0.9 0.0 116.5sec 116.5sec 18.62% 18.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:18.62%

Trigger Attempt Success

  • trigger_pct:69.87%
void_tendril: raid_movement 0.5 0.0 145.7sec 145.7sec 15.80% 15.80% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:15.83%

Trigger Attempt Success

  • trigger_pct:46.70%
void_tendril: raid_movement 0.4 0.0 0.0sec 0.0sec 12.48% 12.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.75%

Trigger Attempt Success

  • trigger_pct:38.46%
void_tendril: raid_movement 1.0 0.0 0.0sec 0.0sec 35.72% 35.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Faelik_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:35.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Faelik
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Faelik
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 161.30 612.00 (1066.69%) 3.79 33.19 5.14%
Insanity Drained by Voidform Insanity 5926.38 -4643.47 (-8093.40%) -0.78 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 62.43 737.92 (1286.17%) 11.82 11.24 1.50%
Insanity Gained from Mind Flay Insanity 164.20 328.37 (572.34%) 2.00 0.03 0.01%
Insanity Gained from Mind Sear Insanity 500.08 678.61 (1182.80%) 1.36 71.50 9.53%
Insanity Gained from Power Infusion Insanity 254.62 241.86 (421.55%) 0.95 48.54 16.72%
Insanity Gained from Shadow Word: Death Insanity 8.06 78.48 (136.80%) 9.74 2.19 2.72%
Insanity Gained from Shadow Word: Pain Casts Insanity 52.06 156.07 (272.02%) 3.00 0.12 0.07%
Insanity Gained from Vampiric Touch Casts Insanity 41.14 164.56 (286.82%) 4.00 0.01 0.01%
Insanity Gained from Void Bolt Insanity 104.19 1401.08 (2442.03%) 13.45 265.91 15.95%
Insanity Saved by Void Torrent Insanity 408.68 301.89 (526.19%) 0.74 0.00 0.00%
Health from Vampiric Touch Ticks Health 529.99 0.00 (0.00%) 0.00 26989764.06 100.00%
mp5_regen Mana 1002.60 0.00 (0.00%) 0.00 3520349.12 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.74 11.60
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 57.32 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 162.5 2.4sec
Void Eruption casted when a target with both DoTs was up 12.2 39.2sec
Void Eruption casted when a target with no DoTs was up 8.6 48.7sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.8 121.5sec
Void Eruption casted when a target with only Vampiric Touch was up 25.0 38.7sec
Void Tendril spawned from Call to the Void 9.0 42.9sec

Statistics & Data Analysis

Fight Length
Sample Data Faelik Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Faelik Damage Per Second
Count 9999
Mean 442552.11
Minimum 379852.35
Maximum 513607.01
Spread ( max - min ) 133754.65
Range [ ( max - min ) / 2 * 100% ] 15.11%
Standard Deviation 21246.7886
5th Percentile 410749.57
95th Percentile 481405.91
( 95th Percentile - 5th Percentile ) 70656.35
Mean Distribution
Standard Deviation 212.4785
95.00% Confidence Intervall ( 442135.66 - 442968.56 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 88
0.1% Error 8854
0.1 Scale Factor Error with Delta=300 3853632
0.05 Scale Factor Error with Delta=300 15414528
0.01 Scale Factor Error with Delta=300 385363220
Priority Target DPS
Sample Data Faelik Priority Target Damage Per Second
Count 9999
Mean 298654.51
Minimum 272704.24
Maximum 325529.15
Spread ( max - min ) 52824.91
Range [ ( max - min ) / 2 * 100% ] 8.84%
Standard Deviation 6785.0079
5th Percentile 287126.85
95th Percentile 309252.33
( 95th Percentile - 5th Percentile ) 22125.48
Mean Distribution
Standard Deviation 67.8535
95.00% Confidence Intervall ( 298521.52 - 298787.50 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 19
0.1% Error 1982
0.1 Scale Factor Error with Delta=300 392992
0.05 Scale Factor Error with Delta=300 1571970
0.01 Scale Factor Error with Delta=300 39299260
DPS(e)
Sample Data Faelik Damage Per Second (Effective)
Count 9999
Mean 442552.11
Minimum 379852.35
Maximum 513607.01
Spread ( max - min ) 133754.65
Range [ ( max - min ) / 2 * 100% ] 15.11%
Damage
Sample Data Faelik Damage
Count 9999
Mean 170754117.07
Minimum 133972900.56
Maximum 203040831.51
Spread ( max - min ) 69067930.94
Range [ ( max - min ) / 2 * 100% ] 20.22%
DTPS
Sample Data Faelik Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Faelik Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Faelik Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Faelik Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Faelik Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Faelik Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data FaelikTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Faelik Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
B 2.00 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
C 1.01 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
D 10.39 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
E 2.56 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
F 1.06 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
G 14.31 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
H 25.13 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
I 5.80 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
J 10.66 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
K 16.28 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
L 3.58 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
0.00 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
M 20.45 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
N 1.63 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
O 0.61 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
P 81.57 void_bolt
Q 6.84 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
R 1.93 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
0.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
S 52.80 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
T 5.07 shadow_word_death,if=cooldown.shadow_word_death.charges=2
U 2.33 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
V 0.00 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
W 0.22 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
X 16.25 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Y 28.52 mind_sear,if=active_enemies>=3,interrupt=1
Z 34.80 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
a 31.21 shadow_word_pain

Sample Sequence

012456BCJGJBJKDQOSZMaaLMSXMXSMaUMSPYPSPYPSPYPSPZaPSZPZKKKKGHHHHHIDaaPSYPYSPYPSZPQPSZPaaMaSMXHHGHIDaYPSYPYSPZPSZPaZMaaMSHHHHHIGDYPaYPSYPZPQPSXMXLSMXXMSXNYPSPYPSaPYPSPZPSPZGJKKKHGHHHDXYNSYPYPSYPaaPSZPZPQMaaMSKHHGHHIDYSPYPSYPZPSZPZPUaKKGHKHHHIEEDSYPYSPYPaSPZPQaMaaLMSXMXXMSYPYPSPYPSPZPSJKJGJKEDaaMSXMXXMSXPYPSYPYSPZPSZPRJGJFGDQPaSPZPSTPZPSZPZTPSZPZGJ7FJGJDaZPZPSTPZPSZPZTPSZLPZPRSJGJ

Sample Sequence Table

time name target resources buffs
Pre flask Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Faelik 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.100 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity bloodlust, potion_of_deadly_grace
0:01.972 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity bloodlust, potion_of_deadly_grace
0:06.558 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity bloodlust, potion_of_deadly_grace
0:07.429 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity bloodlust, potion_of_deadly_grace
0:10.781 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity bloodlust, potion_of_deadly_grace
0:11.654 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity bloodlust, potion_of_deadly_grace
0:12.773 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity bloodlust, raid_movement, potion_of_deadly_grace
0:13.645 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, potion_of_deadly_grace
0:13.645 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity bloodlust, sphere_of_insanity, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:17.893 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.7/100: 81% insanity bloodlust, sphere_of_insanity, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:18.722 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:19.546 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.5/100: 92% insanity bloodlust, sphere_of_insanity, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:20.707 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 86.9/100: 87% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:21.515 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.2/100: 91% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:22.316 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.4/100: 85% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(9), insanity_drain_stacks(6), potion_of_deadly_grace
0:23.111 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity bloodlust, raid_movement, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
0:23.111 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
0:23.863 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.1/100: 95% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
0:24.618 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
0:25.367 void_bolt Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 93.4/100: 93% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
0:26.116 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
0:26.867 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(14), insanity_drain_stacks(11)
0:27.707 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 93.3/100: 93% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
0:28.462 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.5/100: 89% insanity bloodlust, raid_movement, power_infusion, sphere_of_insanity, voidform(15), insanity_drain_stacks(12)
0:29.211 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
0:29.961 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
0:30.714 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 80% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
0:31.730 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.6/100: 84% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
0:32.483 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity bloodlust, power_infusion, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
0:33.553 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.9/100: 95% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17), mind_sear_on_hit_reset
0:34.302 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.3/100: 87% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18), mind_sear_on_hit_reset
0:35.053 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.1/100: 89% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
0:36.017 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
0:37.110 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.3/100: 93% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21), mind_sear_on_hit_reset
0:37.865 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:38.621 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
0:39.531 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(23)
0:40.958 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.4/100: 82% insanity bloodlust, power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:41.922 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(26)
0:43.044 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(27)
0:43.968 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.7/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(28)
0:45.066 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.0/100: 51% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(29)
0:45.922 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.5/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(30)
0:46.775 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.8/100: 31% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31)
0:47.620 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.4/100: 22% insanity twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(31)
0:48.464 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(32)
0:49.300 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.9/100: 1% insanity twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(33)
0:50.396 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity raid_movement, lingering_insanity(36)
0:51.229 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.0/100: 9% insanity raid_movement, lingering_insanity(36)
0:52.063 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity raid_movement, lingering_insanity(36)
0:52.897 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity raid_movement, lingering_insanity(36)
0:53.730 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 26.0/100: 26% insanity lingering_insanity(36)
0:54.562 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity lingering_insanity(36)
0:55.395 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity lingering_insanity(36)
0:56.230 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity lingering_insanity(36)
0:57.064 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity lingering_insanity(36)
0:57.896 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(36)
0:58.731 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity lingering_insanity(36)
1:00.076 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity raid_movement, lingering_insanity(36), mind_sear_on_hit_reset
1:00.076 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(36), insanity_drain_stacks, mind_sear_on_hit_reset
1:00.903 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.8/100: 85% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(36), insanity_drain_stacks, mind_sear_on_hit_reset
1:01.721 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.6/100: 81% insanity sphere_of_insanity, voidform(2), lingering_insanity(36), insanity_drain_stacks(2), mind_sear_on_hit_reset
1:02.533 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.4/100: 92% insanity sphere_of_insanity, voidform(3), lingering_insanity(36), insanity_drain_stacks(3)
1:03.344 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity sphere_of_insanity, voidform(4), lingering_insanity(36), insanity_drain_stacks(4)
1:04.690 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(36), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:05.480 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(36), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:06.655 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.2/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(36), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:07.435 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(36), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:08.250 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.2/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:10.303 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.3/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
1:11.321 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
1:12.333 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
1:13.334 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
1:14.324 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.5/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:16.278 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(16)
1:17.244 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.3/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(17)
1:18.203 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(18)
1:19.155 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(19)
1:20.097 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.8/100: 64% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
1:21.034 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.7/100: 54% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
1:21.961 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 39.6/100: 40% insanity raid_movement, sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
1:22.883 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.5/100: 38% insanity raid_movement, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
1:23.800 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.7/100: 23% insanity sphere_of_insanity, voidform(24), insanity_drain_stacks(23)
1:24.713 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 16.7/100: 17% insanity sphere_of_insanity, voidform(25), insanity_drain_stacks(24)
1:25.614 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 14.1/100: 14% insanity sphere_of_insanity, voidform(26), insanity_drain_stacks(25)
1:26.514 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(27)
1:27.406 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(27)
1:28.296 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(27)
1:29.189 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(27)
1:30.081 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(27)
1:32.335 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity raid_movement, lingering_insanity(27), mind_sear_on_hit_reset
1:32.335 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity raid_movement, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, mind_sear_on_hit_reset
1:33.217 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.3/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, mind_sear_on_hit_reset
1:34.780 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(27), insanity_drain_stacks(3), mind_sear_on_hit_reset
1:35.643 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(27), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:36.501 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.3/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(27), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:37.853 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(27), insanity_drain_stacks(6), mind_sear_on_hit_reset
1:38.690 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.0/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(27), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:40.057 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.6/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(27), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:41.022 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.0/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:42.053 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:44.318 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
1:45.321 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
1:46.324 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
1:47.317 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
1:48.293 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
1:49.260 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.9/100: 50% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
1:50.459 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 31.3/100: 31% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
1:51.410 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.2/100: 34% insanity raid_movement, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
1:52.351 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.1/100: 20% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
1:53.287 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 5.0/100: 5% insanity raid_movement, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
1:54.213 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.9/100: 8% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
1:55.143 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(23)
1:56.065 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(23)
1:56.987 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(23)
1:57.907 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(23)
1:58.827 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(23)
1:59.750 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(23)
2:01.320 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity lingering_insanity(23), mind_sear_on_hit_reset
2:02.243 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity lingering_insanity(23), mind_sear_on_hit_reset
2:02.243 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity sphere_of_insanity, voidform, lingering_insanity(23), insanity_drain_stacks, mind_sear_on_hit_reset
2:04.000 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.2/100: 81% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(23), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:04.947 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.9/100: 96% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(23), insanity_drain_stacks(3), mind_sear_on_hit_reset
2:05.834 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.4/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(23), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:07.311 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.3/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(23), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:08.181 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.7/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(23), insanity_drain_stacks(6), mind_sear_on_hit_reset
2:09.052 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.9/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(23), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:10.474 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
2:11.510 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
2:13.749 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.5/100: 68% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
2:14.753 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
2:18.920 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(13)
2:19.882 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.5/100: 80% insanity sphere_of_insanity, voidform(18), insanity_drain_stacks(14)
2:20.836 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 65.6/100: 66% insanity sphere_of_insanity, voidform(19), insanity_drain_stacks(15)
2:21.788 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 58.4/100: 58% insanity sphere_of_insanity, voidform(20), insanity_drain_stacks(16)
2:22.726 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 58.7/100: 59% insanity sphere_of_insanity, voidform(21), insanity_drain_stacks(17)
2:23.663 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.6/100: 47% insanity sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
2:23.663 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.6/100: 47% insanity power_infusion, sphere_of_insanity, voidform(22), insanity_drain_stacks(18)
2:24.486 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 47.7/100: 48% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
2:25.240 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 54.2/100: 54% insanity power_infusion, sphere_of_insanity, voidform(23), insanity_drain_stacks(19)
2:25.987 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 45.7/100: 46% insanity power_infusion, sphere_of_insanity, voidform(24), insanity_drain_stacks(20)
2:26.737 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 36.7/100: 37% insanity power_infusion, sphere_of_insanity, voidform(25), insanity_drain_stacks(21)
2:27.491 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.5/100: 42% insanity power_infusion, sphere_of_insanity, voidform(26), insanity_drain_stacks(22)
2:28.245 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 42.2/100: 42% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
2:28.999 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 32.2/100: 32% insanity power_infusion, sphere_of_insanity, voidform(27), insanity_drain_stacks(23)
2:29.750 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.2/100: 42% insanity power_infusion, sphere_of_insanity, voidform(28), insanity_drain_stacks(24)
2:31.053 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.1/100: 54% insanity power_infusion, sphere_of_insanity, voidform(29), insanity_drain_stacks(25), mind_sear_on_hit_reset
2:31.857 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.3/100: 62% insanity power_infusion, sphere_of_insanity, voidform(30), insanity_drain_stacks(26), mind_sear_on_hit_reset
2:33.182 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.1/100: 49% insanity power_infusion, sphere_of_insanity, voidform(31), insanity_drain_stacks(27)
2:33.930 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(28)
2:35.132 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(29), mind_sear_on_hit_reset
2:35.973 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.5/100: 59% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(30), mind_sear_on_hit_reset
2:36.723 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.7/100: 47% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(31)
2:37.473 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.5/100: 37% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(32)
2:38.225 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 39.5/100: 39% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(32)
2:39.441 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.2/100: 48% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mind_sear_on_hit_reset
2:40.206 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.2/100: 48% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(34), mind_sear_on_hit_reset
2:41.404 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(40), insanity_drain_stacks(36)
2:42.159 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.5/100: 43% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(40), insanity_drain_stacks(36)
2:43.130 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.4/100: 34% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(41), insanity_drain_stacks(37)
2:44.189 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.1/100: 35% insanity twist_of_fate, sphere_of_insanity, voidform(42), insanity_drain_stacks(38)
2:45.616 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 10.5/100: 11% insanity twist_of_fate, sphere_of_insanity, voidform(44), insanity_drain_stacks(40)
2:46.401 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.9/100: 4% insanity twist_of_fate, sphere_of_insanity, voidform(45), insanity_drain_stacks(41)
2:48.136 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(45)
2:48.918 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, lingering_insanity(45)
2:50.248 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity raid_movement, lingering_insanity(45)
2:51.030 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity raid_movement, lingering_insanity(45)
2:51.812 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity raid_movement, lingering_insanity(45)
2:52.594 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity lingering_insanity(45)
2:53.375 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.0/100: 49% insanity lingering_insanity(45)
2:54.362 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 61.0/100: 61% insanity lingering_insanity(45)
2:55.143 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity lingering_insanity(45)
2:55.924 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity lingering_insanity(45)
2:56.705 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity lingering_insanity(45)
2:56.705 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity sphere_of_insanity, voidform, lingering_insanity(45), insanity_drain_stacks
2:57.482 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.2/100: 70% insanity sphere_of_insanity, voidform, lingering_insanity(45), insanity_drain_stacks
2:58.707 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity sphere_of_insanity, voidform(3), lingering_insanity(45), insanity_drain_stacks(3), mind_sear_on_hit_reset
2:59.466 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity sphere_of_insanity, voidform(3), lingering_insanity(45), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:00.224 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.5/100: 100% insanity sphere_of_insanity, voidform(4), lingering_insanity(45), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:01.524 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity sphere_of_insanity, voidform(5), lingering_insanity(45), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:02.270 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.8/100: 98% insanity sphere_of_insanity, voidform(6), lingering_insanity(45), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:03.611 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.2/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(45), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:04.468 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(45), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:05.445 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:07.112 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
3:08.129 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.0/100: 94% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
3:09.137 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.5/100: 91% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
3:10.137 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
3:11.126 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
3:12.112 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
3:13.090 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
3:14.055 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:16.124 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.2/100: 46% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20)
3:17.064 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.7/100: 49% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
3:20.148 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 45.9/100: 46% insanity raid_movement, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
3:21.059 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.8/100: 44% insanity raid_movement, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
3:21.962 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.4/100: 29% insanity raid_movement, sphere_of_insanity, voidform(26), insanity_drain_stacks(23)
3:22.858 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 14.4/100: 14% insanity raid_movement, sphere_of_insanity, voidform(27), insanity_drain_stacks(24)
3:23.750 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.4/100: 17% insanity sphere_of_insanity, voidform(28), insanity_drain_stacks(25)
3:24.634 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(28)
3:25.520 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(28)
3:26.406 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 7.0/100: 7% insanity lingering_insanity(28)
3:27.290 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity lingering_insanity(28)
3:28.411 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity lingering_insanity(28)
3:29.297 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(28)
3:30.184 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(28)
3:32.750 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity lingering_insanity(28), mind_sear_on_hit_reset
3:32.750 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity sphere_of_insanity, voidform, lingering_insanity(28), insanity_drain_stacks, mind_sear_on_hit_reset
3:34.108 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.8/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(28), insanity_drain_stacks(2), mind_sear_on_hit_reset
3:34.976 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.9/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(28), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:35.834 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(28), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:37.516 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.8/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(28), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:38.355 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(28), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:39.190 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.4/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(28), insanity_drain_stacks(7), mind_sear_on_hit_reset
3:40.298 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.8/100: 96% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(28), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:41.217 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:43.495 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.1/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
3:44.509 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.4/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12)
3:45.520 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.6/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
3:46.523 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.6/100: 54% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14)
3:47.510 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.8/100: 54% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
3:49.723 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.6/100: 26% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17)
3:50.683 shadowfiend Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.4/100: 25% insanity raid_movement, sphere_of_insanity, voidform(18), insanity_drain_stacks(18)
3:51.636 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.4/100: 8% insanity raid_movement, sphere_of_insanity, voidform(19), insanity_drain_stacks(19)
3:52.579 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(20)
3:53.522 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity raid_movement, lingering_insanity(20)
3:54.466 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity lingering_insanity(20)
3:55.408 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 18.0/100: 18% insanity lingering_insanity(20)
3:56.352 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.0/100: 22% insanity raid_movement, lingering_insanity(20)
3:57.295 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity lingering_insanity(20)
3:58.239 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 33.0/100: 33% insanity lingering_insanity(20)
3:59.184 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity lingering_insanity(20)
4:00.127 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.0/100: 45% insanity lingering_insanity(20)
4:01.597 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity lingering_insanity(20), mind_sear_on_hit_reset
4:02.540 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(20), mind_sear_on_hit_reset
4:03.484 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity lingering_insanity(20), mind_sear_on_hit_reset
4:03.484 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity sphere_of_insanity, voidform, lingering_insanity(20), insanity_drain_stacks, mind_sear_on_hit_reset
4:04.419 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(20), insanity_drain_stacks
4:05.758 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.4/100: 96% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(20), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:06.673 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(20), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:08.143 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(20), insanity_drain_stacks(5), mind_sear_on_hit_reset
4:09.043 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(20), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:09.928 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.2/100: 94% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(20), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:11.670 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
4:12.739 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
4:13.766 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.4/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), mind_sear_on_hit_reset
4:14.786 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.7/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
4:15.793 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.3/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13)
4:18.010 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(15), insanity_drain_stacks(15)
4:18.989 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16)
4:20.198 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.6/100: 62% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(16)
4:21.160 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 48.7/100: 49% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(17)
4:22.114 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.5/100: 53% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(18)
4:23.061 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.8/100: 43% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(19)
4:23.999 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.7/100: 29% insanity twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
4:23.999 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.7/100: 29% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(20)
4:24.749 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.9/100: 35% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(21)
4:25.502 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 35.7/100: 36% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
4:26.258 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 26.4/100: 26% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(22)
4:27.007 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 31.6/100: 32% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(23)
4:27.760 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 21.6/100: 22% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(24)
4:28.513 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 16.5/100: 17% insanity raid_movement, power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(25)
4:29.267 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.8/100: 21% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(25)
4:30.016 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.0/100: 25% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(27), insanity_drain_stacks(26)
4:31.177 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(28), insanity_drain_stacks(27), mind_sear_on_hit_reset
4:31.928 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.4/100: 42% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(29), insanity_drain_stacks(28), mind_sear_on_hit_reset
4:33.030 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 45.2/100: 45% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(30), insanity_drain_stacks(29), mind_sear_on_hit_reset
4:34.017 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.2/100: 47% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(31), insanity_drain_stacks(30), mind_sear_on_hit_reset
4:35.329 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.4/100: 31% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(32), insanity_drain_stacks(31), mind_sear_on_hit_reset
4:36.079 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.4/100: 33% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(33), insanity_drain_stacks(32), mind_sear_on_hit_reset
4:37.197 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(34), insanity_drain_stacks(33), mind_sear_on_hit_reset
4:38.107 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.1/100: 40% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(35), insanity_drain_stacks(34), mind_sear_on_hit_reset
4:39.355 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.9/100: 23% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(36), insanity_drain_stacks(35), mind_sear_on_hit_reset
4:40.104 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.4/100: 23% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(37), insanity_drain_stacks(36), mind_sear_on_hit_reset
4:41.095 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 9.3/100: 9% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(38), insanity_drain_stacks(37)
4:42.073 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.6/100: 4% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(39), insanity_drain_stacks(38)
4:42.827 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity power_infusion, twist_of_fate, lingering_insanity(39)
4:44.946 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.5/100: 32% insanity raid_movement, twist_of_fate, lingering_insanity(39)
4:45.762 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.5/100: 39% insanity twist_of_fate, lingering_insanity(39)
4:48.443 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.5/100: 55% insanity twist_of_fate, lingering_insanity(39)
4:49.258 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.5/100: 67% insanity twist_of_fate, lingering_insanity(39)
4:50.332 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.5/100: 69% insanity raid_movement, twist_of_fate, lingering_insanity(39)
4:51.146 shadow_word_pain Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 71.5/100: 72% insanity raid_movement, twist_of_fate, lingering_insanity(39)
4:51.961 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity raid_movement, twist_of_fate, lingering_insanity(39)
4:51.961 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.5/100: 75% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(39), insanity_drain_stacks
4:52.768 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.3/100: 70% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(39), insanity_drain_stacks
4:53.568 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 66.1/100: 66% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(39), insanity_drain_stacks(2)
4:54.363 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(39), insanity_drain_stacks(3)
4:55.155 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(39), insanity_drain_stacks(4)
4:55.940 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 82.9/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(39), insanity_drain_stacks(4)
4:56.715 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(39), insanity_drain_stacks(5)
4:57.491 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 85.9/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(39), insanity_drain_stacks(6)
4:58.260 void_bolt Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(39), insanity_drain_stacks(7)
4:59.021 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.8/100: 88% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(39), insanity_drain_stacks(8)
4:59.777 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 90.8/100: 91% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(39), insanity_drain_stacks(8)
5:00.744 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.6/100: 87% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(9)
5:01.775 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10)
5:03.796 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 98.1/100: 98% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
5:04.801 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.1/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), mind_sear_on_hit_reset
5:05.803 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.1/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), mind_sear_on_hit_reset
5:07.373 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.7/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), mind_sear_on_hit_reset
5:08.345 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.1/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), mind_sear_on_hit_reset
5:09.903 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.8/100: 71% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), mind_sear_on_hit_reset
5:10.863 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), mind_sear_on_hit_reset
5:11.804 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.6/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), mind_sear_on_hit_reset
5:13.902 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.9/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
5:14.821 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 33.9/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(23)
5:15.743 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.9/100: 28% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(24)
5:16.878 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(25)
5:17.779 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.1/100: 5% insanity twist_of_fate, sphere_of_insanity, voidform(26), insanity_drain_stacks(26)
5:18.675 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity twist_of_fate, lingering_insanity(27)
5:19.934 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(27)
5:20.829 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity twist_of_fate, lingering_insanity(27)
5:26.995 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.0/100: 58% insanity twist_of_fate, lingering_insanity(27)
5:27.888 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(27)
5:28.782 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, lingering_insanity(27)
5:28.782 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.0/100: 84% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks
5:32.248 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(4), lingering_insanity(27), insanity_drain_stacks
5:33.103 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.1/100: 90% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(27), insanity_drain_stacks(2)
5:33.950 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.2/100: 85% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(27), insanity_drain_stacks(3)
5:34.792 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(27), insanity_drain_stacks(4)
5:35.627 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(27), insanity_drain_stacks(4)
5:37.577 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.7/100: 79% insanity twist_of_fate, sphere_of_insanity, voidform(9), insanity_drain_stacks(6)
5:38.607 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.3/100: 82% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(7)
5:39.635 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(8)
5:40.647 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 82.8/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(9)
5:41.651 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(10)
5:43.952 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.5/100: 66% insanity twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(13)
5:44.927 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.2/100: 67% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(14)
5:45.896 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.1/100: 68% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(15)
5:46.854 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.9/100: 57% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(16)
5:47.806 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.7/100: 58% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(17)
5:49.050 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.4/100: 36% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(18)
5:49.984 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(19)
5:50.912 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.8/100: 38% insanity twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(20)
5:51.832 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.6/100: 33% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
5:52.745 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.5/100: 20% insanity twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(21)
5:53.652 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.4/100: 22% insanity twist_of_fate, sphere_of_insanity, voidform(25), insanity_drain_stacks(22)
5:55.681 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.0/100: 2% insanity twist_of_fate, lingering_insanity(27)
5:56.574 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 14.0/100: 14% insanity twist_of_fate, lingering_insanity(27)
5:59.114 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, lingering_insanity(27)
5:59.114 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
6:00.008 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
6:02.534 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.0/100: 56% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
6:03.426 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
6:04.674 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity raid_movement, twist_of_fate, lingering_insanity(27), potion_of_deadly_grace
6:04.674 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.0/100: 78% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, potion_of_deadly_grace
6:05.559 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.3/100: 73% insanity twist_of_fate, sphere_of_insanity, voidform, lingering_insanity(27), insanity_drain_stacks, potion_of_deadly_grace
6:06.441 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 69.2/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(2), lingering_insanity(27), insanity_drain_stacks(2), potion_of_deadly_grace
6:07.309 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.9/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(3), lingering_insanity(27), insanity_drain_stacks(3), potion_of_deadly_grace
6:09.231 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.8/100: 69% insanity twist_of_fate, sphere_of_insanity, voidform(5), lingering_insanity(27), insanity_drain_stacks(5), potion_of_deadly_grace
6:10.076 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.5/100: 83% insanity twist_of_fate, sphere_of_insanity, voidform(6), lingering_insanity(27), insanity_drain_stacks(6), potion_of_deadly_grace
6:10.916 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.5/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(7), lingering_insanity(27), insanity_drain_stacks(7), potion_of_deadly_grace
6:11.750 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.3/100: 86% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(27), insanity_drain_stacks(8), potion_of_deadly_grace
6:12.577 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, sphere_of_insanity, voidform(8), lingering_insanity(27), insanity_drain_stacks(8), potion_of_deadly_grace
6:14.528 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.5/100: 72% insanity twist_of_fate, sphere_of_insanity, voidform(10), insanity_drain_stacks(10), potion_of_deadly_grace
6:15.628 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.2/100: 77% insanity twist_of_fate, sphere_of_insanity, voidform(11), insanity_drain_stacks(11), potion_of_deadly_grace
6:16.649 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.2/100: 75% insanity twist_of_fate, sphere_of_insanity, voidform(12), insanity_drain_stacks(12), potion_of_deadly_grace
6:17.660 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.2/100: 64% insanity twist_of_fate, sphere_of_insanity, voidform(13), insanity_drain_stacks(13), potion_of_deadly_grace
6:18.654 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.2/100: 65% insanity twist_of_fate, sphere_of_insanity, voidform(14), insanity_drain_stacks(14), potion_of_deadly_grace
6:20.267 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.6/100: 44% insanity raid_movement, twist_of_fate, sphere_of_insanity, voidform(16), insanity_drain_stacks(16), potion_of_deadly_grace
6:21.238 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(17), insanity_drain_stacks(17), potion_of_deadly_grace
6:22.201 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.8/100: 37% insanity twist_of_fate, sphere_of_insanity, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace
6:23.160 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.2/100: 32% insanity twist_of_fate, sphere_of_insanity, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace
6:24.109 power_infusion Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.1/100: 19% insanity twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace
6:24.109 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 19.1/100: 19% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace
6:24.862 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.4/100: 25% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(21), insanity_drain_stacks(21)
6:26.538 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.1/100: 3% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(22), insanity_drain_stacks(22)
6:27.286 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.2/100: 8% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(23), insanity_drain_stacks(23)
6:28.037 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 5.7/100: 6% insanity power_infusion, twist_of_fate, sphere_of_insanity, voidform(24), insanity_drain_stacks(24)
6:28.793 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity power_infusion, twist_of_fate, lingering_insanity(24)
6:34.046 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity power_infusion, twist_of_fate, lingering_insanity(24)
6:34.801 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity power_infusion, twist_of_fate, lingering_insanity(24)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6253 5928 0
Agility 7827 7502 0
Stamina 33510 33510 20603
Intellect 32613 30907 22110 (765)
Spirit 5 5 0
Health 2010600 2010600 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 32613 30907 0
Crit 20.83% 20.83% 5541
Haste 32.99% 31.83% 10346
Damage / Heal Versatility 0.73% 0.73% 290
ManaReg per Second 8800 8800 0
Mastery 41.70% 41.70% 3039
Armor 1623 1623 1623
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 858.00
Local Head Night Dreamer Crest
ilevel: 850, stats: { 211 Armor, +1297 Int, +1945 Sta, +904 Haste, +400 Mastery }
Local Neck An'she's Pendant
ilevel: 845, stats: { +1045 Sta, +1184 Haste, +617 Crit }
Local Shoulders Shoulderpads of Crashing Waves
ilevel: 855, stats: { 199 Armor, +1019 Int, +1529 Sta, +627 Mastery, +370 Crit }
Local Chest Night Dreamer Robe
ilevel: 840, stats: { 251 Armor, +1182 Int, +1773 Sta, +899 Haste, +359 Mastery }
Local Waist Roggthread Cord
ilevel: 860, stats: { 152 Armor, +1068 Int, +1601 Sta, +726 Haste, +290 Vers }
Local Legs Ragged Horrorweave Leggings
ilevel: 850, stats: { 228 Armor, +1945 Sta, +1297 Int, +736 Haste, +568 Mastery }
Local Feet Cozy Dryad Hoof-Socks
ilevel: 850, stats: { 179 Armor, +1459 Sta, +973 Int, +658 Haste, +322 Crit }
Local Wrists Cinch of Cosmic Insignficance
ilevel: 850, stats: { 114 Armor, +1094 Sta, +729 Int, +509 Haste, +225 Mastery }
Local Hands Ink-Smudged Handwraps
ilevel: 840, stats: { 157 Armor, +886 Int, +1329 Sta, +552 Mastery, +391 Haste }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 880, stats: { +1448 Sta, +1409 Crit, +645 Haste }, enchant: { +150 Crit }
Local Finger2 Sephuz's Secret
ilevel: 895, stats: { +1665 Sta, +620 Haste, +1552 Crit }, gems: { +150 Crit }, enchant: { +150 Crit }
Local Trinket1 Nightmare Bloom
ilevel: 845, stats: { +1177 Int, +412 Avoidance, +915 Haste }
Local Trinket2 Swarming Plaguehive
ilevel: 850, stats: { +932 Haste }, gems: { +200 Int }
Local Back Evergreen Vinewrap Drape
ilevel: 855, stats: { 132 Armor, +765 StrAgiInt, +1147 Sta, +502 Haste, +245 Crit }, gems: { +150 Haste }, enchant: { +150 Int }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 883, weapon: { 1551 - 2882, 1.8 }, stats: { +756 Int, +1134 Sta, +321 Crit, +308 Mastery, +9619 Int }, relics: { +45 ilevels, +46 ilevels, +42 ilevels }
Local Off Hand Secrets of the Void
ilevel: 883, stats: { +992 Int, +1489 Sta, +575 Haste, +255 Crit }
Local Tabard Renowned Guild Tabard
ilevel: 1

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Faelik"
origin="https://us.api.battle.net/wow/character/thrall/Faelik/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/187/153787323-avatar.jpg"
level=110
race=undead
role=spell
position=back
professions=alchemy=650/herbalism=800
talents=1211211
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:769:1:770:1:771:3:772:3:773:3:775:3:776:3:777:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=night_dreamer_crest,id=139086,bonus_id=3432/1512/3337
neck=anshes_pendant,id=139101,bonus_id=3473/1808/1507/3336
shoulders=shoulderpads_of_crashing_waves,id=137360,bonus_id=3411/1507/3336
back=evergreen_vinewrap_drape,id=139248,bonus_id=1807/1808/1477/3336,gems=150haste,enchant=150int
chest=night_dreamer_robe,id=139089,bonus_id=3473/1502/1674
tabard=renowned_guild_tabard,id=69210
wrists=cinch_of_cosmic_insignficance,id=139187,bonus_id=1807/1472
hands=inksmudged_handwraps,id=134421,bonus_id=1727/1492/1813
waist=roggthread_cord,id=134171,bonus_id=3410/1522/3337
legs=ragged_horrorweave_leggings,id=139190,bonus_id=1807/1472
feet=cozy_dryad_hoofsocks,id=139194,bonus_id=1807/1472
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1805/1502/3337,enchant=150crit
finger2=sephuzs_secret,id=132452,bonus_id=1811,gems=150crit,enchant=150crit
trinket1=nightmare_bloom,id=121311,bonus_id=3474/40/604/1507/1674
trinket2=swarming_plaguehive,id=139321,bonus_id=1807/1808/1472,gems=200int
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=141273/142180/137347/0,relic_id=3474:1517:3336/3453:1472/3411:1497:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=858.19
# gear_stamina=20603
# gear_intellect=22110
# gear_crit_rating=5541
# gear_haste_rating=10346
# gear_mastery_rating=3039
# gear_versatility_rating=290
# gear_avoidance_rating=412
# gear_armor=1623

Raji

Raji : 360413 dps, 250149 dps to main target

  • Race: Troll
  • Class: Priest
  • Spec: Shadow
  • Level: 110
  • Role: Spell
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
360413.4 360413.4 299.7 / 0.083% 58477.7 / 16.2% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 0.67% 47.5 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Raji/advanced
Talents
  • 15: Twist of Fate (Shadow Priest)
  • 30: Body and Soul
  • 45: Mind Bomb (Shadow Priest)
  • 60: Reaper of Souls (Shadow Priest)
  • 75: Auspicious Spirits (Shadow Priest)
  • 90: Mindbender (Shadow Priest)
  • 100: Legacy of the Void (Shadow Priest)
  • Talent Calculator
Artifact
Professions
  • tailoring: 762
  • enchanting: 716
Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.94 10.36 9.53 8.72 8.01
Normalized 1.00 0.95 0.87 0.80 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.37
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.94, CritRating=9.53, HasteRating=10.36, MasteryRating=8.01, Versatility=8.72 )

Scale Factors for other metrics

Scale Factors for Raji Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 10.94 10.36 9.53 8.72 8.01
Normalized 1.00 0.95 0.87 0.80 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.37
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.94, CritRating=9.53, HasteRating=10.36, MasteryRating=8.01, Versatility=8.72 )
Scale Factors for Raji Priority Target Damage Per Second
Int Haste Crit Vers Mastery
Scale Factors 7.85 7.37 7.29 6.07 5.62
Normalized 1.00 0.94 0.93 0.77 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.13 0.13 0.13 0.13 0.13
Gear Ranking
Optimizers
Ranking
  • Int > Haste ~= Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=7.85, CritRating=7.29, HasteRating=7.37, MasteryRating=5.62, Versatility=6.07 )
Scale Factors for Raji Damage Per Second (Effective)
Int Haste Crit Vers Mastery
Scale Factors 10.94 10.36 9.53 8.72 8.01
Normalized 1.00 0.95 0.87 0.80 0.73
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Int > Haste > Crit > Vers > Mastery
Pawn string ( Pawn: v1: "Raji": Intellect=10.94, CritRating=9.53, HasteRating=10.36, MasteryRating=8.01, Versatility=8.72 )
Scale Factors for Raji Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for Raji Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )
Scale Factors for RajiTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Raji": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Up%
Raji 360413
Deadly Grace 9260 2.5% 28.1 14.75sec 130334 0 Direct 28.0 97398 194838 130461 33.9%  

Stats details: deadly_grace

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.06 28.03 0.00 0.00 0.0000 0.0000 3656874.69 3656874.69 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 18.52 66.07% 97397.85 88847 106617 97389.72 91217 103883 1803828 1803828 0.00
crit 9.51 33.93% 194838.49 177695 213234 194816.78 177695 213234 1853047 1853047 0.00
 
 

Action details: deadly_grace

Static Values
  • id:188091
  • school:arcane
  • resource:none
  • range:40.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188091
  • name:Deadly Grace
  • school:arcane
  • tooltip:
  • description:Deal {$s1=63339 to 95008} Arcane damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:63338.72
  • base_dd_max:95008.08
 
Mind Blast 23379 6.5% 47.6 8.35sec 196835 175327 Direct 48.6 144009 288081 192781 33.9%  

Stats details: mind_blast

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.55 48.55 0.00 0.00 1.1227 0.0000 9360186.57 9360186.57 0.00 175327.08 175327.08
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 32.12 66.15% 144009.00 107169 167183 144024.29 130187 155564 4625130 4625130 0.00
crit 16.44 33.85% 288080.80 214337 334366 288140.67 242916 325507 4735057 4735057 0.00
 
 

Action details: mind_blast

Static Values
  • id:8092
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8092
  • name:Mind Blast
  • school:shadow
  • tooltip:
  • description:Blasts the target's mind for {$s1=0} Shadow damage.$?a185916[ |cFFFFFFFFGenerates {$/100;s2=12} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.750000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Mind Flay 12976 3.7% 47.1 8.54sec 112407 70865 Periodic 123.3 32066 64139 42919 33.8% 16.2%

Stats details: mind_flay

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 47.09 0.00 123.32 123.32 1.5862 0.5276 5292767.65 5292767.65 0.00 70865.03 70865.03
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.6 66.16% 32066.39 23337 36478 31995.76 29439 34020 2616365 2616365 0.00
crit 41.7 33.84% 64138.54 46673 72957 64007.44 57003 70213 2676403 2676403 0.00
 
 

Action details: mind_flay

Static Values
  • id:15407
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.mind_spike.enabled
Spelldata
  • id:15407
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=3 seconds}$?s120585[. Each time Mind Flay deals damage, the Priest will be granted $120587s1% increased movement speed for $120587d, stacking up to $120587u times.][ and slowing their movement speed by {$s2=50}%.]$?a185916[ |cFFFFFFFFGenerates ${4*$m3/100} Insanity over the duration.|r][]
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.550000
  • base_td:1.00
  • dot_duration:3.00
  • base_tick_time:0.75
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Mind Sear 38649 10.6% 27.4 10.50sec 559058 312687 Periodic 398.7 28648 57299 38355 33.9% 10.4%

Stats details: mind_sear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.35 0.00 70.04 398.72 1.7879 0.5936 15292880.61 15292880.61 0.00 312686.69 312686.69
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 263.6 66.12% 28648.25 22001 34321 28672.21 26738 30943 7552596 7552596 0.00
crit 135.1 33.88% 57299.40 44001 68642 57346.74 52878 62649 7740284 7740284 0.00
 
 

Action details: mind_sear

Static Values
  • id:48045
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3
Spelldata
  • id:48045
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing Shadow damage to all targets within $49821a2 yards.
  • description:Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:5.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: mind_sear_tick

Static Values
  • id:49821
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:49821
  • name:Mind Sear
  • school:shadow
  • tooltip:Causing shadow damage to all targets within $a2 yards.
  • description:{$@spelldesc48045=Corrosive shadow energy radiates from the target, dealing ${$49821m2*6} Shadow damage over {$48045d=5 seconds} to all enemies within $49821a2 yards of the target. |cFFFFFFFFGenerates ${$208232m1*6/100} Insanity over the duration per target hit.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.540000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Shadow Word: Death 8619 2.4% 14.2 10.16sec 241755 222123 Direct 14.2 180785 361401 241770 33.8%  

Stats details: shadow_word_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.22 14.22 0.00 0.00 1.0885 0.0000 3437571.68 3437571.68 0.00 222122.75 222122.75
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.42 66.24% 180785.41 118595 185009 180839.15 157732 185009 1702839 1702839 0.00
crit 4.80 33.76% 361400.82 237190 370017 359965.56 0 370017 1734733 1734733 0.00
 
 

Action details: shadow_word_death

Static Values
  • id:32379
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
Spelldata
  • id:32379
  • name:Shadow Word: Death
  • school:shadow
  • tooltip:
  • description:A word of dark binding that inflicts {$s1=1} Shadow damage to the target. Only usable on enemies that have less than {$s2=20}% health. |cFFFFFFFFGenerates {$s3=10} Insanity, or $/100;190714s1 if the target dies.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:3.250000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shadow Word: Pain 44266 12.3% 40.7 9.59sec 434931 418749 Direct 40.7 34691 69324 46428 33.9%  
Periodic 290.6 40618 81242 54380 33.9% 103.0%

Stats details: shadow_word_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 40.67 40.67 290.56 290.56 1.0387 1.4195 17688807.68 17688807.68 0.00 38903.35 418749.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 26.89 66.11% 34691.16 26955 42049 34704.17 31806 38147 932723 932723 0.00
crit 13.78 33.89% 69323.69 53909 84098 69360.02 57144 81762 955559 955559 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 192.1 66.12% 40618.12 151 46151 40627.89 39483 41891 7803781 7803781 0.00
crit 98.4 33.88% 81241.82 363 92302 81243.22 76884 85327 7996745 7996745 0.00
 
 

Action details: shadow_word_pain

Static Values
  • id:589
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<(3+(4%3))*gcd
Spelldata
  • id:589
  • name:Shadow Word: Pain
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A word of darkness that causes {$s1=1} Shadow damage instantly, and an additional $o2 Shadow damage over {$d=14 seconds}.$?a185916[ |cFFFFFFFFGenerates ${$m3/100} Insanity.|r][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.410000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.450000
  • base_td:1.00
  • dot_duration:14.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Shadowy Apparitions 14990 4.2% 169.5 2.33sec 35293 0 Direct 168.1 26596 53188 35602 33.9%  

Stats details: shadowy_apparitions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 169.55 168.08 0.00 0.00 0.0000 0.0000 5983959.38 5983959.38 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 111.16 66.13% 26596.21 19485 30397 26600.74 24805 28426 2956452 2956452 0.00
crit 56.92 33.87% 53188.05 38970 60794 53193.50 48951 57194 3027507 3027507 0.00
 
 

Action details: shadowy_apparitions

Static Values
  • id:78203
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:6.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:78203
  • name:Shadowy Apparitions
  • school:physical
  • tooltip:
  • description:When your Shadow Word: Pain damage over time critically strikes, you also create a shadowy version of yourself that floats towards the target and deals {$148859s1=0} Shadow damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.275000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Vampiric Touch 80543 22.3% 33.6 9.09sec 954828 889525 Periodic 350.0 68452 136903 91615 33.8% 186.0%

Stats details: vampiric_touch

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 33.59 0.00 350.04 350.04 1.0734 2.1281 32068253.38 32068253.38 0.00 41063.24 889524.66
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 231.6 66.16% 68451.77 157 78959 68469.00 66198 71247 15852793 15852793 0.00
crit 118.4 33.84% 136903.27 136 157917 136933.35 130187 144298 16215460 16215460 0.00
 
 

Action details: vampiric_touch

Static Values
  • id:34914
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.vampiric_touch.remains<(4+(4%3))*gcd
Spelldata
  • id:34914
  • name:Vampiric Touch
  • school:shadow
  • tooltip:Suffering $w2 Shadow damage every $t2 sec.
  • description:A touch of darkness that causes $34914o2 Shadow damage over {$34914d=18 seconds}, and heals the Priest for ${$e2*100}% of damage dealt. If Vampiric Touch is dispelled, the dispeller flees in Horror for {$87204d=3 seconds}. |cFFFFFFFFGenerates ${$m3/100} Insanity.|r
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.790000
  • base_td:1.00
  • dot_duration:18.00
  • base_tick_time:3.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Void Bolt 50226 14.0% 79.6 4.89sec 252245 234513 Direct 79.4 189058 378180 253095 33.9%  

Stats details: void_bolt

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 79.65 79.38 0.00 0.00 1.0756 0.0000 20090253.52 20090253.52 0.00 234512.93 234512.93
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.50 66.14% 189058.16 128135 199891 189049.60 183435 194929 9925793 9925793 0.00
crit 26.88 33.86% 378180.28 256270 399781 378175.53 356947 396274 10164461 10164461 0.00
 
 

Action details: void_bolt

Static Values
  • id:205448
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:20.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10
Spelldata
  • id:205448
  • name:Void Bolt
  • school:shadow
  • tooltip:
  • description:Sends a bolt of pure void energy at the enemy, causing {$s1=1} Shadow damage$?a231688[ and refreshing Shadow Word: Pain and Vampiric Touch to their original duration][]. Requires Voidform. |cFFFFFFFFGenerates {$/100;s3=16} Insanity.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:2.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Eruption 9961 2.8% 11.5 35.40sec 345417 0 Direct 49.9 59550 119123 79705 33.8%  

Stats details: void_eruption

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.52 49.95 0.00 0.00 0.0000 0.0000 3980874.79 3980874.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 33.05 66.17% 59550.12 53143 63771 59547.35 54369 63476 1968055 1968055 0.00
crit 16.90 33.83% 119123.37 106285 127542 119118.59 107536 127542 2012820 2012820 0.00
 
 

Action details: void_eruption

Static Values
  • id:228360
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:18.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:4.500
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
Spelldata
  • id:228360
  • name:Void Eruption
  • school:shadow
  • tooltip:
  • description:{$@spelldesc228260=Releases an explosive blast of pure void energy, activating Voidform and causing {$228360s1=1} Shadow damage to all enemies afflicted by your Shadow Word: Pain or Vampiric Touch. During Voidform, this ability is replaced by Void Bolt. |cFFFFFFFFRequires ${$C/100} Insanity to activate.|r}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.500000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Void Torrent 15267 4.2% 6.9 61.20sec 882295 237208 Periodic 41.9 108949 217785 145846 33.9% 5.9%

Stats details: void_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.92 0.00 41.87 41.87 3.7195 0.5677 6107149.28 6107149.28 0.00 237207.69 237207.69
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.7 66.10% 108948.91 129 121589 108926.37 91702 120745 3015532 3015532 0.00
crit 14.2 33.90% 217784.94 310 243179 217725.59 127498 243179 3091618 3091618 0.00
 
 

Action details: void_torrent

Static Values
  • id:205065
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:205065
  • name:Void Torrent
  • school:shadow
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:true
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:2.200000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
Volatile Ichor 31074 8.6% 21.5 18.42sec 571342 0 Direct 72.8 126388 252851 169075 33.8%  

Stats details: volatile_ichor

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.53 72.76 0.00 0.00 0.0000 0.0000 12301370.51 12301370.51 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.20 66.25% 126388.26 116278 139534 126491.41 117335 138993 6091874 6091874 0.00
crit 24.56 33.75% 252851.45 232556 279068 253059.92 232556 279068 6209497 6209497 0.00
 
 

Action details: volatile_ichor

Static Values
  • id:222187
  • school:nature
  • resource:none
  • range:0.0
  • travel_speed:25.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:222187
  • name:Volatile Ichor
  • school:physical
  • tooltip:
  • description:Your ranged attacks and spells have a chance to summon a Volatile Ichor, which creeps towards the target and explodes on contact, dealing {$s1=65033} Nature damage within $222197A1 yards.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:103616.84
  • base_dd_max:103616.84
 
pet - mindbender 60742 / 15957
melee 60742 4.4% 89.0 4.37sec 71654 63628 Direct 89.0 53521 107030 71654 33.9%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 89.02 89.02 0.00 0.00 1.1261 0.0000 6378557.65 6378557.65 0.00 63628.41 63628.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 58.85 66.11% 53520.87 47363 54468 53518.80 52626 54331 3149833 3149833 0.00
crit 30.17 33.89% 107029.93 94726 108935 107024.93 103252 108935 3228725 3228725 0.00
 
 

Action details: melee

Static Values
  • id:0
  • school:shadow
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
pet - void_tendril 30184 / 4681
Mind Flay (_void_tendril) 30184 (33520) 1.3% (2.3%) 8.9 41.55sec 364963 72911 Periodic 44.8 31576 63153 42283 33.9% 11.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.95 0.00 44.78 44.78 5.0056 1.0000 1893447.37 1893447.37 0.00 72911.01 72911.01
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 29.6 66.09% 31576.46 31576 31576 31576.46 31576 31576 934545 934545 0.00
crit 15.2 33.91% 63152.91 63153 63153 63152.91 63153 63153 958902 958902 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 30885 0.3% 2.0 62.09sec 209545 42287 Periodic 9.8 31576 63153 42285 33.9% 2.5%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.98 0.00 9.83 9.83 4.9554 1.0000 415804.96 415804.96 0.00 42286.68 42286.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.5 66.08% 31576.46 31576 31576 31365.22 0 31576 205187 205187 0.00
crit 3.3 33.92% 63152.91 63153 63153 59592.11 0 63153 210618 210618 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 31496 0.2% 1.4 15.27sec 215064 42139 Periodic 7.3 31576 63153 42135 33.4% 1.8%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.44 0.00 7.34 7.34 5.1042 1.0000 309216.45 309216.45 0.00 42139.06 42139.06
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.9 66.56% 31576.46 31576 31576 31212.67 0 31576 154244 154244 0.00
crit 2.5 33.44% 63152.91 63153 63153 58059.94 0 63153 154972 154972 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 31248 0.2% 1.4 4.73sec 218606 42735 Periodic 7.0 31576 63153 42735 35.3% 1.7%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.37 0.00 7.00 7.00 5.1154 1.0000 299145.38 299145.38 0.00 42735.05 42735.05
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.5 64.66% 31576.46 31576 31576 29914.54 0 31576 142925 142925 0.00
crit 2.5 35.34% 63152.91 63153 63153 56505.24 0 63153 156220 156220 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
    Mind Flay (_void_tendril) 34734 0.2% 1.0 0.00sec 347341 38593 Periodic 9.0 31576 63153 38593 22.2% 2.2%

Stats details: mind_flay_void_tendril

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 9.00 9.00 9.0000 1.0000 347341.02 347341.02 0.00 38593.45 38593.45
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 7.0 77.78% 31576.46 31576 31576 31576.46 31576 31576 221035 221035 0.00
crit 2.0 22.22% 63152.91 63153 63153 63152.91 63153 63153 126306 126306 0.00
 
 

Action details: mind_flay_void_tendril

Static Values
  • id:193473
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:193473
  • name:Mind Flay
  • school:shadow
  • tooltip:$?$w2=0[Taking][Movement speed slowed and taking] Shadow damage every $t1 sec.
  • description:Assaults the target's mind with Shadow energy, causing $o1 Shadow damage over {$d=15 seconds} and slowing their movement speed by {$s2=50}%.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:1.000000
  • base_td:1.00
  • dot_duration:10.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Simple Action Stats Execute Interval
Raji
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Berserking 2.6 185.77sec

Stats details: berserking

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.58 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: berserking

Static Values
  • id:26297
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:buff.voidform.stack>=90
Spelldata
  • id:26297
  • name:Berserking
  • school:physical
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Raji
  • harmful:false
  • if_expr:
 
Mindbender 7.1 60.46sec

Stats details: mindbender

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.11 0.00 0.00 0.00 1.1376 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: mindbender

Static Values
  • id:200174
  • school:shadow
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:talent.mindbender.enabled&!talent.surrender_to_madness.enabled
Spelldata
  • id:200174
  • name:Mindbender
  • school:shadow
  • tooltip:
  • description:Summons a Mindbender to attack the target for {$d=15 seconds}. |cFFFFFFFFGenerates {$s3=4} Insanity each time the Mindbender attacks.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shadowform 1.0 0.00sec

Stats details: shadowform

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowform

Static Values
  • id:232698
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.shadowform.up
Spelldata
  • id:232698
  • name:Shadowform
  • school:shadow
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
 
pet - mindbender
Shadowcrawl 21.1 18.92sec

Stats details: shadowcrawl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.07 0.00 0.00 0.00 1.1436 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shadowcrawl

Static Values
  • id:63619
  • school:arcane
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:63619
  • name:Shadowcrawl
  • school:arcane
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Berserking 2.6 0.0 185.8sec 185.8sec 6.32% 8.13% 0.0(0.0) 2.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_berserking
  • max_stacks:1
  • duration:10.00
  • cooldown:180.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • berserking_1:6.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:26297
  • name:Berserking
  • tooltip:Haste increased by {$s1=15}%.
  • description:Increases your haste by {$s1=15}% for {$d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:180.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 11.54% 0.0(0.0) 1.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
insanity_drain_stacks 11.5 267.8 35.4sec 35.4sec 74.11% 74.11% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_insanity_drain_stacks
  • max_stacks:999
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • insanity_drain_stacks_1:3.64%
  • insanity_drain_stacks_2:2.95%
  • insanity_drain_stacks_3:2.88%
  • insanity_drain_stacks_4:3.04%
  • insanity_drain_stacks_5:3.36%
  • insanity_drain_stacks_6:3.56%
  • insanity_drain_stacks_7:3.10%
  • insanity_drain_stacks_8:3.24%
  • insanity_drain_stacks_9:3.52%
  • insanity_drain_stacks_10:3.07%
  • insanity_drain_stacks_11:2.86%
  • insanity_drain_stacks_12:3.16%
  • insanity_drain_stacks_13:2.99%
  • insanity_drain_stacks_14:2.99%
  • insanity_drain_stacks_15:2.88%
  • insanity_drain_stacks_16:2.89%
  • insanity_drain_stacks_17:2.78%
  • insanity_drain_stacks_18:2.70%
  • insanity_drain_stacks_19:2.64%
  • insanity_drain_stacks_20:2.41%
  • insanity_drain_stacks_21:2.08%
  • insanity_drain_stacks_22:1.84%
  • insanity_drain_stacks_23:1.58%
  • insanity_drain_stacks_24:1.33%
  • insanity_drain_stacks_25:1.20%
  • insanity_drain_stacks_26:1.06%
  • insanity_drain_stacks_27:0.89%
  • insanity_drain_stacks_28:0.77%
  • insanity_drain_stacks_29:0.70%
  • insanity_drain_stacks_30:0.60%
  • insanity_drain_stacks_31:0.51%
  • insanity_drain_stacks_32:0.41%
  • insanity_drain_stacks_33:0.28%
  • insanity_drain_stacks_34:0.15%
  • insanity_drain_stacks_35:0.04%
  • insanity_drain_stacks_36:0.01%
  • insanity_drain_stacks_37:0.00%
  • insanity_drain_stacks_38:0.00%
  • insanity_drain_stacks_39:0.00%
  • insanity_drain_stacks_40:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%
Lingering Insanity 11.5 0.0 33.8sec 33.8sec 23.81% 23.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_lingering_insanity
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • lingering_insanity_13:0.00%
  • lingering_insanity_14:0.00%
  • lingering_insanity_15:0.00%
  • lingering_insanity_16:0.05%
  • lingering_insanity_17:0.28%
  • lingering_insanity_18:0.57%
  • lingering_insanity_19:1.27%
  • lingering_insanity_20:2.56%
  • lingering_insanity_21:1.66%
  • lingering_insanity_22:0.62%
  • lingering_insanity_23:0.39%
  • lingering_insanity_24:0.66%
  • lingering_insanity_25:0.94%
  • lingering_insanity_26:1.80%
  • lingering_insanity_27:1.74%
  • lingering_insanity_28:1.47%
  • lingering_insanity_29:1.13%
  • lingering_insanity_30:0.81%
  • lingering_insanity_31:0.57%
  • lingering_insanity_32:0.59%
  • lingering_insanity_33:0.68%
  • lingering_insanity_34:1.01%
  • lingering_insanity_35:1.15%
  • lingering_insanity_36:1.38%
  • lingering_insanity_37:1.49%
  • lingering_insanity_38:0.59%
  • lingering_insanity_39:0.26%
  • lingering_insanity_40:0.09%
  • lingering_insanity_41:0.04%
  • lingering_insanity_42:0.01%
  • lingering_insanity_43:0.00%
  • lingering_insanity_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197937
  • name:Lingering Insanity
  • tooltip:Haste increased by $w1%.
  • description:{$@spelldesc194249={$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}}
  • max_stacks:100
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
mind_sear_on_hit_reset 12.1 15.3 24.7sec 10.5sec 26.07% 26.07% 0.0(0.0) 11.9

Buff details

  • buff initial source:Raji
  • cooldown name:buff_mind_sear_on_hit_reset
  • max_stacks:2
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • mind_sear_on_hit_reset_1:26.07%

Trigger Attempt Success

  • trigger_pct:100.00%
Potion of Deadly Grace 2.0 0.0 363.3sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_potion_of_deadly_grace
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_deadly_grace_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188027
  • name:Potion of Deadly Grace
  • tooltip:Your attacks have a chance to unleash a bolt of energy at your target.
  • description:Grants your attacks a chance to unleash a bolt of energy at your target. Staying away from enemies for the entire duration of the effect will extend the effect by an additional 5 seconds.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.52% 14.52% 2.0(2.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.52%

Trigger Attempt Success

  • trigger_pct:100.00%
Twist of Fate 8.5 406.7 29.4sec 0.9sec 63.09% 63.09% 406.7(406.7) 7.5

Buff details

  • buff initial source:Raji
  • cooldown name:buff_twist_of_fate
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • twist_of_fate_1:63.09%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:109142
  • name:Twist of Fate
  • tooltip:
  • description:After {$?s15407=true}[damaging][healing] a target below {$s1=35}% health, you deal {$123254s2=20}% increased damage and {$123254s1=20}% increased healing for {$123254d=10 seconds}.
  • max_stacks:0
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
Void Torrent 6.9 0.0 61.2sec 61.2sec 6.08% 6.08% 0.0(0.0) 5.2

Buff details

  • buff initial source:Raji
  • cooldown name:buff_void_torrent
  • max_stacks:1
  • duration:4.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • void_torrent_1:6.08%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:205065
  • name:Void Torrent
  • tooltip:Dealing {$s1=1} Shadow damage to the target every $t sec. Insanity drain temporarily stopped.
  • description:Raise your dagger into the sky, channeling a torrent of void energy into the target for $o Shadow damage over {$d=4 seconds}. Insanity does not drain during this channel. Requires Voidform.
  • max_stacks:0
  • duration:4.00
  • cooldown:60.00
  • default_chance:0.00%
Voidform 11.5 0.0 35.4sec 35.4sec 74.11% 66.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji
  • cooldown name:buff_voidform
  • max_stacks:100
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • voidform_1:2.87%
  • voidform_2:2.86%
  • voidform_3:2.86%
  • voidform_4:2.85%
  • voidform_5:2.85%
  • voidform_6:2.84%
  • voidform_7:2.83%
  • voidform_8:2.83%
  • voidform_9:2.82%
  • voidform_10:2.81%
  • voidform_11:2.80%
  • voidform_12:2.80%
  • voidform_13:2.79%
  • voidform_14:2.78%
  • voidform_15:2.77%
  • voidform_16:2.77%
  • voidform_17:2.74%
  • voidform_18:2.69%
  • voidform_19:2.61%
  • voidform_20:2.38%
  • voidform_21:2.14%
  • voidform_22:2.03%
  • voidform_23:1.96%
  • voidform_24:1.89%
  • voidform_25:1.77%
  • voidform_26:1.55%
  • voidform_27:1.27%
  • voidform_28:1.05%
  • voidform_29:0.89%
  • voidform_30:0.77%
  • voidform_31:0.69%
  • voidform_32:0.62%
  • voidform_33:0.56%
  • voidform_34:0.48%
  • voidform_35:0.38%
  • voidform_36:0.28%
  • voidform_37:0.14%
  • voidform_38:0.06%
  • voidform_39:0.02%
  • voidform_40:0.01%
  • voidform_41:0.00%
  • voidform_42:0.00%
  • voidform_43:0.00%
  • voidform_44:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194249
  • name:Voidform
  • tooltip:Cooldown on Mind Blast reduced by ${$w6/1000} sec. Shadow damage dealt increased by $w1%. Haste increased by $w3%. Losing ${$w2/500} Insanity every sec.
  • description:{$@spelldesc228264=Activated by casting Void Eruption. Twists your Shadowform with the powers of the Void, increasing all damage you deal by {$194249s1=30}%{$?s8092=true}[, reducing the cooldown on Mind Blast by ${$194249m6/-1000} sec,][] and granting an additional $194249m3% Haste every $194249t5 sec. Your Insanity will drain increasingly fast until it reaches 0 and Voidform ends. When Voidform ends, you return to normal Shadowform, and you gain Lingering Insanity, allowing the Haste bonus to persist for {$197937d=60 seconds} or until you next enter Voidform.}
  • max_stacks:100
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%
mindbender: raid_movement 0.0 0.0 0.0sec 0.0sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:0.00%

Trigger Attempt Success

  • trigger_pct:0.04%
mindbender: Shadowcrawl 21.1 0.0 18.9sec 18.9sec 86.69% 86.62% 0.0(0.0) 14.0

Buff details

  • buff initial source:Raji_mindbender
  • cooldown name:buff_shadowcrawl
  • max_stacks:1
  • duration:5.00
  • cooldown:6.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shadowcrawl_1:86.69%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:63619
  • name:Shadowcrawl
  • tooltip:Damage increased by {$s2=15}%.
  • description:Crawls through the shadows to the target enemy, and increases damage done by {$s2=15}% for {$d=5 seconds}.
  • max_stacks:0
  • duration:5.00
  • cooldown:6.00
  • default_chance:0.00%
void_tendril: raid_movement 3.9 0.0 69.9sec 69.9sec 19.81% 19.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:19.81%

Trigger Attempt Success

  • trigger_pct:100.00%
void_tendril: raid_movement 0.7 0.0 134.9sec 134.9sec 16.69% 16.69% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:16.71%

Trigger Attempt Success

  • trigger_pct:56.33%
void_tendril: raid_movement 0.4 0.0 200.0sec 200.0sec 14.81% 14.81% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.92%

Trigger Attempt Success

  • trigger_pct:41.94%
void_tendril: raid_movement 0.4 0.0 0.0sec 0.0sec 13.15% 13.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Raji_void_tendril
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:19.22%

Trigger Attempt Success

  • trigger_pct:36.84%
Constant Buffs
Well Fed (azshari_salad)

Buff details

  • buff initial source:Raji
  • cooldown name:buff_azshari_salad
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:375.00

Stack Uptimes

  • azshari_salad_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225603
  • name:Well Fed
  • tooltip:Haste increased by $w1.
  • description:Increases haste by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Defiled Augmentation

Buff details

  • buff initial source:Raji
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Whispered Pact

Buff details

  • buff initial source:Raji
  • cooldown name:buff_flask_of_the_whispered_pact
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:intellect
  • amount:1300.00

Stack Uptimes

  • flask_of_the_whispered_pact_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188031
  • name:Flask of the Whispered Pact
  • tooltip:Intellect increased by $w1.
  • description:Increases Intellect by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Shadowform

Buff details

  • buff initial source:Raji
  • cooldown name:buff_shadowform
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • shadowform_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:232698
  • name:Shadowform
  • tooltip:Shadow damage dealt increased by {$s1=10}%. Physical damage taken reduced by {$s2=10}%.
  • description:Assume a Shadowform, increasing your Shadow damage dealt by {$s1=10}%, and reducing your Physical damage taken by {$s2=10}%.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Raji
Resource Gains Type Count Total Average Overflow
Insanity Gained from Auspicious Spirits Insanity 168.08 630.78 (1110.14%) 3.75 41.54 6.18%
Insanity Drained by Voidform Insanity 5930.94 -4348.18 (-7652.57%) -0.73 0.00 -0.00%
Insanity Gained from Mind Blast Insanity 48.55 577.43 (1016.25%) 11.89 5.21 0.89%
Insanity Gained from Mind Flay Insanity 123.32 246.62 (434.04%) 2.00 0.02 0.01%
Insanity Gained from Mind Sear Insanity 398.71 582.56 (1025.28%) 1.46 15.51 2.59%
Insanity Gained from Mindbender Insanity 89.02 310.83 (547.05%) 3.49 45.24 12.71%
Insanity Gained from Shadow Word: Death Insanity 14.22 380.11 (668.98%) 26.73 46.47 10.89%
Insanity Gained from Shadow Word: Pain Casts Insanity 40.67 120.99 (212.94%) 2.97 1.02 0.83%
Insanity Gained from Vampiric Touch Casts Insanity 33.59 134.08 (235.97%) 3.99 0.27 0.20%
Insanity Gained from Void Bolt Insanity 79.65 1110.44 (1954.31%) 13.94 163.90 12.86%
Insanity Saved by Void Torrent Insanity 485.56 311.15 (547.60%) 0.64 0.00 0.00%
Health from Vampiric Touch Ticks Health 350.04 0.00 (0.00%) 0.00 16034214.49 100.00%
mp5_regen Mana 656.98 0.00 (0.00%) 0.00 3518648.09 100.00%
Resource RPS-Gain RPS-Loss
Insanity 11.00 10.86
Combat End Resource Mean Min Max
Mana 1100000.00 1100000.00 1100000.00
Insanity 56.96 0.00 100.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Shadowy Apparition Insanity lost to overflow 169.6 2.3sec
Void Eruption casted when a target with both DoTs was up 12.4 35.4sec
Void Eruption casted when a target with no DoTs was up 14.3 56.3sec
Void Eruption casted when a target with only Shadow Word: Pain was up 0.5 211.4sec
Void Eruption casted when a target with only Vampiric Touch was up 25.2 32.8sec
Void Tendril spawned from Call to the Void 7.1 54.0sec

Statistics & Data Analysis

Fight Length
Sample Data Raji Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Raji Damage Per Second
Count 9999
Mean 360413.37
Minimum 315616.35
Maximum 423857.62
Spread ( max - min ) 108241.28
Range [ ( max - min ) / 2 * 100% ] 15.02%
Standard Deviation 15290.9844
5th Percentile 338068.79
95th Percentile 388254.28
( 95th Percentile - 5th Percentile ) 50185.49
Mean Distribution
Standard Deviation 152.9175
95.00% Confidence Intervall ( 360113.66 - 360713.08 )
Normalized 95.00% Confidence Intervall ( 99.92% - 100.08% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 69
0.1% Error 6914
0.1 Scale Factor Error with Delta=300 1995972
0.05 Scale Factor Error with Delta=300 7983890
0.01 Scale Factor Error with Delta=300 199597252
Priority Target DPS
Sample Data Raji Priority Target Damage Per Second
Count 9999
Mean 250148.63
Minimum 230992.58
Maximum 270120.12
Spread ( max - min ) 39127.54
Range [ ( max - min ) / 2 * 100% ] 7.82%
Standard Deviation 5177.0745
5th Percentile 241503.31
95th Percentile 258492.61
( 95th Percentile - 5th Percentile ) 16989.31
Mean Distribution
Standard Deviation 51.7733
95.00% Confidence Intervall ( 250047.15 - 250250.10 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 16
0.1% Error 1645
0.1 Scale Factor Error with Delta=300 228798
0.05 Scale Factor Error with Delta=300 915192
0.01 Scale Factor Error with Delta=300 22879814
DPS(e)
Sample Data Raji Damage Per Second (Effective)
Count 9999
Mean 360413.37
Minimum 315616.35
Maximum 423857.62
Spread ( max - min ) 108241.28
Range [ ( max - min ) / 2 * 100% ] 15.02%
Damage
Sample Data Raji Damage
Count 9999
Mean 135260949.74
Minimum 106963379.39
Maximum 166969406.20
Spread ( max - min ) 60006026.81
Range [ ( max - min ) / 2 * 100% ] 22.18%
DTPS
Sample Data Raji Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Raji Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Raji Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Raji Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Raji Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Raji Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data RajiTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Raji Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=flask_of_the_whispered_pact
1 0.00 food,type=azshari_salad
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=deadly_grace
5 0.00 shadowform,if=!buff.shadowform.up
6 0.00 mind_blast
Default action list Executed every time the actor is available.
# count action,conditions
7 1.00 potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
0.00 variable,op=set,name=actors_fight_time_mod,value=0
0.00 variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
0.00 variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
0.00 variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
0.00 variable,op=min,name=s2mcheck,value=180
8 0.00 call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
9 0.00 call_action_list,name=vf,if=buff.voidform.up
A 0.00 call_action_list,name=main
actions.main
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
B 4.58 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
C 2.14 shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
D 1.31 vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
E 11.52 void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
0.00 shadow_crash,if=talent.shadow_crash.enabled
0.00 mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
F 1.35 shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
G 1.24 shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
H 12.45 mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
0.00 mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
I 19.27 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
J 8.27 mind_sear,if=active_enemies>=3,interrupt=1,chain=1
K 7.86 mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
0.00 mind_spike,if=talent.mind_spike.enabled
L 9.41 shadow_word_pain
actions.vf
# count action,conditions
0.00 surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
0.00 shadow_crash,if=talent.shadow_crash.enabled
M 2.76 mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
0.00 mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
0.00 power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
0.00 power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
N 2.58 berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
0.00 berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
O 21.22 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
P 2.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
Q 2.05 void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
0.00 void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
R 54.38 void_bolt
S 6.92 void_torrent,if=!talent.surrender_to_madness.enabled
0.00 void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
0.00 shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
T 5.00 shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
U 40.30 mind_blast
0.00 wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
V 7.98 shadow_word_death,if=cooldown.shadow_word_death.charges=2
0.00 shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
0.00 shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
W 0.01 shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
X 0.26 vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
Y 15.05 vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
0.00 shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
0.00 wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
Z 17.43 mind_sear,if=active_enemies>=3,interrupt=1
a 30.84 mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
0.00 mind_spike,if=talent.mind_spike.enabled
b 27.77 shadow_word_pain

Sample Sequence

012456BCDKHESRbURaNRUaRbbObUOYYOUbOYZRUZRZRUZRaRULKLLLLHIIFEYYMRUZRZSRUaRaObbOUIIIIIJHEbZRZURaRUaRbbObLHIIIIIBHJEbZRSRUaRaOUYOYYOUYIJCHEZbQZRUaRaRUbOYIHIIIJBEZUPZbRSRUNaRabObbOUYOYIHJEZPUbRaRUaRbbObHILIIIBHJEZRZSRUVRaRbbOUVOYTOUZRTJHJEZRabRUaRbbOUVOYYOTMRUJEZSRVURaRUaRVaRUaRaHGKEaRUVRaRUaRVa7RUMRTaRTURaKHKLKHESRVaRNUaR

Sample Sequence Table

time name target resources buffs
Pre flask Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre food Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre augmentation Raji 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity
Pre potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
Pre shadowform Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity potion_of_deadly_grace
0:00.000 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:00.000 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity potion_of_deadly_grace
0:01.228 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity bloodlust, potion_of_deadly_grace
0:02.228 vampiric_touch Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity bloodlust, potion_of_deadly_grace
0:03.226 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity bloodlust, potion_of_deadly_grace
0:06.476 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 59.0/100: 59% insanity bloodlust, potion_of_deadly_grace
0:07.475 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity bloodlust, potion_of_deadly_grace
0:07.475 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.0/100: 79% insanity bloodlust, voidform, insanity_drain_stacks, potion_of_deadly_grace
0:11.686 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.7/100: 98% insanity bloodlust, voidform(5), insanity_drain_stacks(2), potion_of_deadly_grace
0:12.635 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.1/100: 97% insanity bloodlust, raid_movement, voidform(6), insanity_drain_stacks(3), potion_of_deadly_grace
0:13.575 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity bloodlust, voidform(7), insanity_drain_stacks(4), potion_of_deadly_grace
0:14.508 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:15.434 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.6/100: 90% insanity bloodlust, voidform(8), insanity_drain_stacks(5), potion_of_deadly_grace
0:17.466 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity bloodlust, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:17.466 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity bloodlust, berserking, voidform(10), insanity_drain_stacks(7), potion_of_deadly_grace
0:18.248 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, berserking, voidform(11), insanity_drain_stacks(8), potion_of_deadly_grace
0:19.032 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.8/100: 95% insanity bloodlust, berserking, voidform(12), insanity_drain_stacks(9), potion_of_deadly_grace
0:19.809 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity bloodlust, berserking, voidform(13), insanity_drain_stacks(10), potion_of_deadly_grace
0:20.576 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.4/100: 89% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:21.338 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.9/100: 82% insanity bloodlust, berserking, raid_movement, voidform(14), insanity_drain_stacks(11), potion_of_deadly_grace
0:22.095 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 74.4/100: 74% insanity bloodlust, berserking, raid_movement, voidform(15), insanity_drain_stacks(12), potion_of_deadly_grace
0:22.847 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 79.5/100: 80% insanity bloodlust, berserking, raid_movement, voidform(16), insanity_drain_stacks(13), potion_of_deadly_grace
0:23.600 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:24.355 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 76.0/100: 76% insanity bloodlust, berserking, voidform(17), insanity_drain_stacks(14)
0:25.104 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 88.1/100: 88% insanity bloodlust, berserking, voidform(18), insanity_drain_stacks(15)
0:25.855 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 80.1/100: 80% insanity bloodlust, berserking, voidform(19), insanity_drain_stacks(16)
0:26.607 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(17)
0:27.361 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity bloodlust, berserking, voidform(20), insanity_drain_stacks(17)
0:28.203 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.8/100: 61% insanity bloodlust, raid_movement, voidform(21), insanity_drain_stacks(18)
0:29.026 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 48.8/100: 49% insanity bloodlust, raid_movement, voidform(22), insanity_drain_stacks(19)
0:29.843 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 50.4/100: 50% insanity bloodlust, voidform(23), insanity_drain_stacks(20)
0:30.657 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.8/100: 48% insanity bloodlust, voidform(24), insanity_drain_stacks(21)
0:32.045 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.2/100: 48% insanity bloodlust, voidform(25), insanity_drain_stacks(22), mind_sear_on_hit_reset
0:32.842 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity bloodlust, voidform(26), insanity_drain_stacks(23), mind_sear_on_hit_reset
0:33.635 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity bloodlust, voidform(27), insanity_drain_stacks(24), mind_sear_on_hit_reset
0:34.909 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.1/100: 49% insanity bloodlust, twist_of_fate, voidform(28), insanity_drain_stacks(25), mind_sear_on_hit_reset
0:35.688 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.3/100: 48% insanity bloodlust, twist_of_fate, voidform(29), insanity_drain_stacks(26), mind_sear_on_hit_reset
0:36.975 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.6/100: 44% insanity bloodlust, twist_of_fate, voidform(30), insanity_drain_stacks(27), mind_sear_on_hit_reset
0:37.987 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.5/100: 36% insanity bloodlust, twist_of_fate, voidform(31), insanity_drain_stacks(28), mind_sear_on_hit_reset
0:38.749 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.7/100: 32% insanity bloodlust, twist_of_fate, voidform(32), insanity_drain_stacks(29), mind_sear_on_hit_reset
0:40.132 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.5/100: 29% insanity bloodlust, twist_of_fate, voidform(33), insanity_drain_stacks(30), mind_sear_on_hit_reset
0:40.882 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.8/100: 28% insanity bloodlust, twist_of_fate, voidform(34), insanity_drain_stacks(31), mind_sear_on_hit_reset
0:42.707 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.3/100: 4% insanity twist_of_fate, voidform(36), insanity_drain_stacks(33), mind_sear_on_hit_reset
0:43.709 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.3/100: 3% insanity twist_of_fate, voidform(37), insanity_drain_stacks(34), mind_sear_on_hit_reset
0:44.657 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity raid_movement, twist_of_fate, lingering_insanity(37)
0:45.606 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.0/100: 11% insanity twist_of_fate, lingering_insanity(37)
0:50.019 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.0/100: 37% insanity raid_movement, lingering_insanity(37)
0:50.969 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity raid_movement, lingering_insanity(37)
0:51.918 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity raid_movement, lingering_insanity(37)
0:52.868 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.0/100: 50% insanity raid_movement, lingering_insanity(37)
0:53.815 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.0/100: 53% insanity lingering_insanity(37)
0:54.765 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity lingering_insanity(37)
0:55.714 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 69.0/100: 69% insanity lingering_insanity(37)
0:56.662 shadow_word_pain Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 73.0/100: 73% insanity lingering_insanity(37)
0:57.612 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity lingering_insanity(37)
0:57.612 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 80.0/100: 80% insanity voidform, insanity_drain_stacks
0:58.895 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 72.7/100: 73% insanity voidform(2), insanity_drain_stacks(2)
1:00.162 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 60.9/100: 61% insanity raid_movement, voidform(3), insanity_drain_stacks(3)
1:01.414 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.9/100: 48% insanity voidform(4), insanity_drain_stacks(4)
1:02.650 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.9/100: 55% insanity voidform(6), insanity_drain_stacks(6)
1:03.875 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.8/100: 65% insanity voidform(7), insanity_drain_stacks(7)
1:05.829 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.2/100: 80% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:07.015 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.6/100: 85% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
1:08.757 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.3/100: 95% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12), mind_sear_on_hit_reset
1:13.072 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.2/100: 97% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
1:14.185 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity twist_of_fate, voidform(17), insanity_drain_stacks(13)
1:15.294 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.0/100: 91% insanity twist_of_fate, voidform(18), insanity_drain_stacks(14)
1:16.749 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.1/100: 74% insanity raid_movement, twist_of_fate, voidform(20), insanity_drain_stacks(16)
1:17.828 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 80.3/100: 80% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17)
1:20.132 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 52.6/100: 53% insanity raid_movement, voidform(23), insanity_drain_stacks(19)
1:21.182 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.7/100: 50% insanity raid_movement, voidform(24), insanity_drain_stacks(20)
1:22.226 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.2/100: 37% insanity raid_movement, voidform(25), insanity_drain_stacks(21)
1:23.258 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 21.2/100: 21% insanity raid_movement, voidform(26), insanity_drain_stacks(22)
1:24.283 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.5/100: 17% insanity voidform(27), insanity_drain_stacks(23)
1:25.305 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(28)
1:26.318 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(28)
1:27.333 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 20.0/100: 20% insanity lingering_insanity(28)
1:28.349 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(28)
1:29.362 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 28.0/100: 28% insanity lingering_insanity(28)
1:30.378 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(28)
1:31.967 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.0/100: 67% insanity lingering_insanity(28), mind_sear_on_hit_reset
1:32.980 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity raid_movement, lingering_insanity(28), mind_sear_on_hit_reset
1:32.980 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity raid_movement, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
1:34.261 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.7/100: 71% insanity voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
1:36.213 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.9/100: 74% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
1:37.456 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.9/100: 85% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
1:39.380 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.7/100: 86% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
1:40.594 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.7/100: 87% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
1:41.786 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 92% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
1:44.408 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.3/100: 64% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
1:45.561 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.6/100: 64% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
1:46.710 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 58.3/100: 58% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
1:47.848 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.2/100: 44% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
1:48.968 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.6/100: 47% insanity raid_movement, twist_of_fate, voidform(16), insanity_drain_stacks(16)
1:50.076 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 30.9/100: 31% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
1:51.175 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 15.0/100: 15% insanity raid_movement, voidform(19), insanity_drain_stacks(19)
1:52.263 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.2/100: 15% insanity raid_movement, voidform(20), insanity_drain_stacks(20)
1:53.342 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity raid_movement, lingering_insanity(21)
1:54.416 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.0/100: 3% insanity lingering_insanity(21)
1:55.488 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(21)
1:56.563 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity lingering_insanity(21)
1:57.636 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(21)
1:58.708 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(21)
1:59.782 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 39.0/100: 39% insanity lingering_insanity(21)
2:00.856 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.0/100: 43% insanity lingering_insanity(21)
2:01.929 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity lingering_insanity(21)
2:03.003 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.0/100: 63% insanity lingering_insanity(21)
2:04.358 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity raid_movement, twist_of_fate, lingering_insanity(21), mind_sear_on_hit_reset
2:04.358 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity raid_movement, twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:05.640 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.7/100: 85% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:07.626 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.4/100: 95% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
2:08.869 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.5/100: 91% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:13.170 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.7/100: 97% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5)
2:14.351 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.9/100: 92% insanity twist_of_fate, voidform(10), insanity_drain_stacks(6)
2:15.531 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 93.5/100: 94% insanity twist_of_fate, voidform(12), insanity_drain_stacks(8)
2:16.690 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.4/100: 83% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
2:17.834 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.4/100: 84% insanity voidform(14), insanity_drain_stacks(10)
2:20.259 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 56.6/100: 57% insanity raid_movement, voidform(16), insanity_drain_stacks(12)
2:21.369 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 56.1/100: 56% insanity voidform(18), insanity_drain_stacks(14)
2:22.469 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 51.5/100: 51% insanity voidform(19), insanity_drain_stacks(15)
2:23.561 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 37.9/100: 38% insanity voidform(20), insanity_drain_stacks(16)
2:24.641 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 40.8/100: 41% insanity voidform(21), insanity_drain_stacks(17)
2:25.714 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 26.1/100: 26% insanity voidform(22), insanity_drain_stacks(18)
2:26.778 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 11.8/100: 12% insanity voidform(23), insanity_drain_stacks(19)
2:27.831 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.9/100: 17% insanity voidform(24), insanity_drain_stacks(20)
2:28.878 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 13.5/100: 13% insanity voidform(25), insanity_drain_stacks(21)
2:29.917 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(26)
2:30.946 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(26)
2:32.575 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:33.605 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.0/100: 54% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:34.636 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity lingering_insanity(26), mind_sear_on_hit_reset
2:34.636 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
2:36.287 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.1/100: 76% insanity raid_movement, twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
2:37.552 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 70.9/100: 71% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
2:38.799 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.2/100: 78% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
2:41.236 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 73.2/100: 73% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7), mind_sear_on_hit_reset
2:42.441 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.8/100: 79% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
2:43.642 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.3/100: 75% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10), mind_sear_on_hit_reset
2:44.821 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.2/100: 64% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
2:45.988 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 63.3/100: 63% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
2:48.483 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.2/100: 43% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
2:49.613 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 44.9/100: 45% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
2:50.728 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.3/100: 27% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
2:51.835 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 11.5/100: 12% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
2:52.932 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 12.5/100: 13% insanity voidform(19), insanity_drain_stacks(19)
2:54.024 vampiric_touch Fluffy_Pillow_Add5 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(19)
2:55.116 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.0/100: 8% insanity lingering_insanity(19)
2:56.207 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(19)
2:57.299 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 32.0/100: 32% insanity lingering_insanity(19)
2:58.389 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity lingering_insanity(19)
2:59.482 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.0/100: 40% insanity lingering_insanity(19)
3:01.124 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity lingering_insanity(19), mind_sear_on_hit_reset
3:02.216 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity lingering_insanity(19), mind_sear_on_hit_reset
3:02.216 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 75.0/100: 75% insanity voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:04.140 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.9/100: 84% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
3:05.413 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.4/100: 99% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:06.655 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.6/100: 95% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5), mind_sear_on_hit_reset
3:08.187 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.3/100: 92% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
3:09.400 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.8/100: 90% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8), mind_sear_on_hit_reset
3:10.596 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9), mind_sear_on_hit_reset
3:14.990 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 94.8/100: 95% insanity twist_of_fate, voidform(13), insanity_drain_stacks(9)
3:16.130 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
3:17.269 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
3:17.466 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.2/100: 86% insanity berserking, twist_of_fate, voidform(16), insanity_drain_stacks(12)
3:18.438 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 76.6/100: 77% insanity berserking, voidform(17), insanity_drain_stacks(13)
3:19.401 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.4/100: 78% insanity berserking, voidform(18), insanity_drain_stacks(14)
3:20.570 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity berserking, raid_movement, voidform(19), insanity_drain_stacks(15)
3:21.518 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 53.8/100: 54% insanity berserking, raid_movement, voidform(20), insanity_drain_stacks(16)
3:22.456 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.1/100: 55% insanity berserking, raid_movement, voidform(21), insanity_drain_stacks(17)
3:23.386 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 42.0/100: 42% insanity berserking, raid_movement, voidform(22), insanity_drain_stacks(18)
3:24.312 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 29.6/100: 30% insanity berserking, raid_movement, voidform(23), insanity_drain_stacks(19)
3:25.227 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 28.5/100: 28% insanity berserking, voidform(24), insanity_drain_stacks(20)
3:26.137 vampiric_touch Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 28.3/100: 28% insanity berserking, voidform(24), insanity_drain_stacks(20)
3:27.049 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 15.2/100: 15% insanity berserking, voidform(25), insanity_drain_stacks(21)
3:28.018 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 16.2/100: 16% insanity voidform(26), insanity_drain_stacks(22)
3:29.049 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity lingering_insanity(27)
3:30.072 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity lingering_insanity(27)
3:31.094 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.0/100: 24% insanity lingering_insanity(27)
3:35.407 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, lingering_insanity(27), mind_sear_on_hit_reset
3:35.407 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 99.0/100: 99% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
3:37.952 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.0/100: 95% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
3:39.204 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.5/100: 88% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
3:40.440 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 74.0/100: 74% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6)
3:41.661 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.9/100: 63% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
3:42.870 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.5/100: 65% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
3:45.394 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.5/100: 49% insanity twist_of_fate, voidform(10), insanity_drain_stacks(10)
3:46.563 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.7/100: 52% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
3:47.724 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 51.3/100: 51% insanity voidform(13), insanity_drain_stacks(13)
3:48.872 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 38.0/100: 38% insanity voidform(14), insanity_drain_stacks(14)
3:50.004 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.9/100: 41% insanity raid_movement, voidform(15), insanity_drain_stacks(15)
3:51.124 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 25.5/100: 26% insanity raid_movement, voidform(16), insanity_drain_stacks(16)
3:52.234 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 10.1/100: 10% insanity raid_movement, voidform(17), insanity_drain_stacks(17)
3:53.335 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.4/100: 7% insanity raid_movement, voidform(18), insanity_drain_stacks(18)
3:54.426 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 0.0/100: 0% insanity lingering_insanity(19)
3:55.519 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity lingering_insanity(19)
3:56.610 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity raid_movement, lingering_insanity(19)
3:57.699 vampiric_touch Fluffy_Pillow_Add4 1100000.0/1100000: 100% mana | 19.0/100: 19% insanity lingering_insanity(19)
3:58.789 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 23.0/100: 23% insanity lingering_insanity(19)
3:59.881 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity lingering_insanity(19)
4:00.973 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 31.0/100: 31% insanity lingering_insanity(19)
4:02.215 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.0/100: 35% insanity lingering_insanity(19)
4:03.306 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.0/100: 55% insanity lingering_insanity(19)
4:04.977 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, lingering_insanity(19), mind_sear_on_hit_reset
4:04.977 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.0/100: 90% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:07.523 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:08.776 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 95.5/100: 96% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:10.742 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 96.2/100: 96% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:12.272 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.3/100: 97% insanity raid_movement, twist_of_fate, voidform(8), insanity_drain_stacks(6), mind_sear_on_hit_reset
4:13.470 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.3/100: 90% insanity twist_of_fate, voidform(9), insanity_drain_stacks(7), mind_sear_on_hit_reset
4:14.661 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.9/100: 92% insanity twist_of_fate, voidform(10), insanity_drain_stacks(8)
4:15.834 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.7/100: 89% insanity twist_of_fate, voidform(11), insanity_drain_stacks(9)
4:16.992 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 89.0/100: 89% insanity twist_of_fate, voidform(13), insanity_drain_stacks(11)
4:19.511 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.4/100: 65% insanity twist_of_fate, voidform(15), insanity_drain_stacks(13)
4:20.632 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.2/100: 68% insanity raid_movement, twist_of_fate, voidform(16), insanity_drain_stacks(14)
4:21.746 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.9/100: 54% insanity raid_movement, twist_of_fate, voidform(17), insanity_drain_stacks(15)
4:22.849 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 39.3/100: 39% insanity raid_movement, twist_of_fate, voidform(18), insanity_drain_stacks(16)
4:23.940 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.7/100: 37% insanity twist_of_fate, voidform(19), insanity_drain_stacks(17)
4:25.032 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.9/100: 30% insanity twist_of_fate, voidform(21), insanity_drain_stacks(19)
4:26.102 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity twist_of_fate, voidform(22), insanity_drain_stacks(20)
4:27.167 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 37.9/100: 38% insanity twist_of_fate, voidform(23), insanity_drain_stacks(21)
4:28.220 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 17.9/100: 18% insanity raid_movement, twist_of_fate, voidform(24), insanity_drain_stacks(22)
4:29.266 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 27.7/100: 28% insanity twist_of_fate, voidform(25), insanity_drain_stacks(23)
4:30.300 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.7/100: 23% insanity twist_of_fate, voidform(26), insanity_drain_stacks(24)
4:31.331 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.3/100: 13% insanity twist_of_fate, voidform(27), insanity_drain_stacks(25)
4:32.849 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 8.8/100: 9% insanity twist_of_fate, voidform(28), insanity_drain_stacks(26), mind_sear_on_hit_reset
4:33.856 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.9/100: 3% insanity twist_of_fate, voidform(29), insanity_drain_stacks(27), mind_sear_on_hit_reset
4:35.033 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.0/100: 34% insanity twist_of_fate, lingering_insanity(30), mind_sear_on_hit_reset
4:36.546 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.0/100: 52% insanity twist_of_fate, lingering_insanity(30), mind_sear_on_hit_reset
4:37.547 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 64.0/100: 64% insanity twist_of_fate, lingering_insanity(30), mind_sear_on_hit_reset
4:39.061 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, lingering_insanity(30), mind_sear_on_hit_reset
4:39.061 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 86.0/100: 86% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
4:41.599 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.4/100: 81% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3), mind_sear_on_hit_reset
4:42.850 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.9/100: 89% insanity twist_of_fate, voidform(4), insanity_drain_stacks(4), mind_sear_on_hit_reset
4:44.335 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.6/100: 79% insanity raid_movement, twist_of_fate, voidform(6), insanity_drain_stacks(6)
4:45.555 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 68.0/100: 68% insanity twist_of_fate, voidform(7), insanity_drain_stacks(7)
4:46.762 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.0/100: 77% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
4:47.964 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 77.6/100: 78% insanity twist_of_fate, voidform(9), insanity_drain_stacks(9)
4:49.155 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.5/100: 67% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
4:50.321 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.7/100: 66% insanity raid_movement, twist_of_fate, voidform(12), insanity_drain_stacks(12)
4:51.475 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 52.2/100: 52% insanity raid_movement, twist_of_fate, voidform(13), insanity_drain_stacks(13)
4:52.618 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 41.9/100: 42% insanity raid_movement, twist_of_fate, voidform(14), insanity_drain_stacks(14)
4:53.750 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 40.7/100: 41% insanity twist_of_fate, voidform(15), insanity_drain_stacks(15)
4:54.878 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 34.3/100: 34% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
4:55.989 void_bolt Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 45.8/100: 46% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
4:57.087 vampiric_touch Fluffy_Pillow_Add1 1100000.0/1100000: 100% mana | 47.0/100: 47% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19)
4:58.180 vampiric_touch Fluffy_Pillow_Add2 1100000.0/1100000: 100% mana | 31.2/100: 31% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20)
4:59.263 void_bolt Fluffy_Pillow_Add3 1100000.0/1100000: 100% mana | 19.2/100: 19% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21)
5:00.333 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 15.2/100: 15% insanity raid_movement, twist_of_fate, voidform(22), insanity_drain_stacks(22)
5:01.395 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.9/100: 25% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23)
5:02.449 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 3.9/100: 4% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24)
5:03.493 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 2.5/100: 2% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25)
5:04.532 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 12.0/100: 12% insanity twist_of_fate, lingering_insanity(25)
5:08.906 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, lingering_insanity(25), mind_sear_on_hit_reset
5:08.906 mind_sear Fluffy_Pillow 1100000.0/1100000: 100% mana | 100.0/100: 100% insanity twist_of_fate, voidform, insanity_drain_stacks, mind_sear_on_hit_reset
5:10.753 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.9/100: 93% insanity twist_of_fate, voidform(2), insanity_drain_stacks(2), mind_sear_on_hit_reset
5:15.112 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 97.0/100: 97% insanity twist_of_fate, voidform(7), insanity_drain_stacks(3)
5:16.321 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 92.0/100: 92% insanity raid_movement, twist_of_fate, voidform(8), insanity_drain_stacks(4)
5:17.516 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 91.4/100: 91% insanity twist_of_fate, voidform(9), insanity_drain_stacks(5)
5:18.704 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 90.7/100: 91% insanity twist_of_fate, voidform(10), insanity_drain_stacks(6)
5:19.876 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.8/100: 86% insanity twist_of_fate, voidform(11), insanity_drain_stacks(7)
5:22.404 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.3/100: 66% insanity twist_of_fate, voidform(14), insanity_drain_stacks(10)
5:23.535 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 66.7/100: 67% insanity twist_of_fate, voidform(15), insanity_drain_stacks(11)
5:24.663 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.6/100: 63% insanity twist_of_fate, voidform(16), insanity_drain_stacks(12)
5:25.781 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 50.3/100: 50% insanity twist_of_fate, voidform(17), insanity_drain_stacks(13)
5:26.881 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 49.8/100: 50% insanity twist_of_fate, voidform(18), insanity_drain_stacks(14)
5:27.971 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.2/100: 62% insanity twist_of_fate, voidform(20), insanity_drain_stacks(16)
5:29.053 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.3/100: 53% insanity twist_of_fate, voidform(21), insanity_drain_stacks(17)
5:30.126 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 54.6/100: 55% insanity twist_of_fate, voidform(22), insanity_drain_stacks(18)
5:31.191 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 48.4/100: 48% insanity twist_of_fate, voidform(23), insanity_drain_stacks(19)
5:32.467 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.0/100: 27% insanity raid_movement, twist_of_fate, voidform(24), insanity_drain_stacks(20)
5:33.510 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 23.5/100: 23% insanity twist_of_fate, voidform(25), insanity_drain_stacks(21)
5:35.705 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 4.0/100: 4% insanity twist_of_fate, lingering_insanity(27)
5:36.728 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(27)
5:37.750 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 46.0/100: 46% insanity twist_of_fate, lingering_insanity(27)
5:42.531 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, lingering_insanity(27)
5:42.531 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.0/100: 72% insanity twist_of_fate, voidform, insanity_drain_stacks
5:45.369 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 61.9/100: 62% insanity twist_of_fate, voidform(3), insanity_drain_stacks(3)
5:46.617 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.3/100: 65% insanity twist_of_fate, voidform(5), insanity_drain_stacks(5)
5:47.854 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 67.6/100: 68% insanity twist_of_fate, voidform(6), insanity_drain_stacks(6)
5:49.071 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 87.9/100: 88% insanity raid_movement, twist_of_fate, voidform(7), insanity_drain_stacks(7)
5:50.278 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 85.6/100: 86% insanity twist_of_fate, voidform(8), insanity_drain_stacks(8)
5:53.008 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.6/100: 58% insanity twist_of_fate, voidform(11), insanity_drain_stacks(11)
5:54.171 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 57.5/100: 57% insanity twist_of_fate, voidform(12), insanity_drain_stacks(12)
5:55.331 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 55.8/100: 56% insanity twist_of_fate, voidform(13), insanity_drain_stacks(13)
5:56.479 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 43.3/100: 43% insanity twist_of_fate, voidform(14), insanity_drain_stacks(14)
5:57.606 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 41.0/100: 41% insanity twist_of_fate, voidform(16), insanity_drain_stacks(16)
5:58.723 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 53.2/100: 53% insanity twist_of_fate, voidform(17), insanity_drain_stacks(17)
5:59.833 potion Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18)
5:59.833 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 37.6/100: 38% insanity twist_of_fate, voidform(18), insanity_drain_stacks(18), potion_of_deadly_grace
6:00.931 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 35.4/100: 35% insanity twist_of_fate, voidform(19), insanity_drain_stacks(19), potion_of_deadly_grace
6:02.023 mindbender Fluffy_Pillow 1100000.0/1100000: 100% mana | 27.6/100: 28% insanity twist_of_fate, voidform(20), insanity_drain_stacks(20), potion_of_deadly_grace
6:03.101 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 7.2/100: 7% insanity twist_of_fate, voidform(21), insanity_drain_stacks(21), potion_of_deadly_grace
6:04.165 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.2/100: 11% insanity raid_movement, twist_of_fate, voidform(22), insanity_drain_stacks(22), potion_of_deadly_grace
6:05.224 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.6/100: 25% insanity twist_of_fate, voidform(23), insanity_drain_stacks(23), potion_of_deadly_grace
6:06.279 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 11.6/100: 12% insanity twist_of_fate, voidform(24), insanity_drain_stacks(24), potion_of_deadly_grace
6:07.321 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 13.8/100: 14% insanity twist_of_fate, voidform(25), insanity_drain_stacks(25), potion_of_deadly_grace
6:08.352 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 29.7/100: 30% insanity twist_of_fate, voidform(26), insanity_drain_stacks(26), potion_of_deadly_grace
6:09.384 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 22.8/100: 23% insanity twist_of_fate, voidform(27), insanity_drain_stacks(27), potion_of_deadly_grace
6:10.398 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 24.8/100: 25% insanity twist_of_fate, voidform(28), insanity_drain_stacks(28), potion_of_deadly_grace
6:12.713 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 6.0/100: 6% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:14.499 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 16.0/100: 16% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:15.499 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 36.0/100: 36% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:20.178 shadow_word_pain Fluffy_Pillow 1100000.0/1100000: 100% mana | 62.0/100: 62% insanity raid_movement, twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:21.177 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 65.0/100: 65% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:22.850 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 71.0/100: 71% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:23.851 void_eruption Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, lingering_insanity(30), potion_of_deadly_grace
6:23.851 void_torrent Fluffy_Pillow 1100000.0/1100000: 100% mana | 83.0/100: 83% insanity twist_of_fate, voidform, insanity_drain_stacks, potion_of_deadly_grace
6:28.148 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 84.3/100: 84% insanity twist_of_fate, voidform(5), insanity_drain_stacks(2)
6:29.376 shadow_word_death Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.2/100: 88% insanity twist_of_fate, voidform(6), insanity_drain_stacks(3)
6:30.593 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 88.0/100: 88% insanity twist_of_fate, voidform(7), insanity_drain_stacks(4)
6:31.807 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 78.5/100: 79% insanity twist_of_fate, voidform(8), insanity_drain_stacks(5)
6:32.997 berserking Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity twist_of_fate, voidform(10), insanity_drain_stacks(7)
6:32.997 mind_blast Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.7/100: 82% insanity berserking, twist_of_fate, voidform(10), insanity_drain_stacks(7)
6:34.024 mind_flay Fluffy_Pillow 1100000.0/1100000: 100% mana | 81.1/100: 81% insanity berserking, twist_of_fate, voidform(11), insanity_drain_stacks(8)
6:35.042 void_bolt Fluffy_Pillow 1100000.0/1100000: 100% mana | 72.9/100: 73% insanity berserking, twist_of_fate, voidform(12), insanity_drain_stacks(9)

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 6255 5930 0
Agility 7831 7506 0
Stamina 33139 33139 20629
Intellect 30951 29245 20529 (729)
Spirit 1 1 0
Health 1988340 1988340 0
Mana 1100000 1100000 0
Insanity 100 100 0
Spell Power 30951 29245 0
Crit 33.86% 33.86% 10102
Haste 15.95% 14.79% 4808
Damage / Heal Versatility 2.02% 2.02% 807
ManaReg per Second 8800 8800 0
Mastery 57.25% 57.25% 5216
Armor 1654 1654 1654
Run Speed 7 0 333

Gear

Source Slot Average Item Level: 859.00
Local Head Hood of Darkened Visions
ilevel: 860, stats: { 219 Armor, +2135 Sta, +1424 Int, +822 Crit, +532 Mastery }
Local Neck Blackened Portalstone Necklace
ilevel: 865, stats: { +1258 Sta, +1276 Crit, +665 Haste, +333 RunSpeed }
Local Shoulders Ancient Dreamwoven Mantle
ilevel: 855, stats: { 199 Armor, +1529 Sta, +1019 Int, +584 Mastery, +413 Crit }
Local Chest Maddening Robe of Secrets
ilevel: 850, stats: { 260 Armor, +1945 Sta, +1297 Int, +876 Mastery, +428 Crit }
Local Waist Bonespeaker Cinch
ilevel: 830, stats: { 136 Armor, +807 Int, +1211 Sta, +551 Crit, +356 Mastery }
Local Legs Legwraps of Rampant Turmoil
ilevel: 845, stats: { 224 Armor, +1238 Int, +1857 Sta, +777 Crit, +503 Haste }
Local Feet Norgannon's Foresight
ilevel: 895, stats: { 210 Armor, +2219 Sta, +1479 Int, +662 Haste, +496 Mastery }
Local Wrists Bracers of the High Priest
ilevel: 840, stats: { 110 Armor, +997 Sta, +665 Int, +475 Crit, +232 Haste }
Local Hands Handwraps of Delusional Power
ilevel: 855, stats: { 166 Armor, +1529 Sta, +1019 Int, +648 Haste, +349 Crit }
Local Finger1 Twice-Warped Azsharan Signet
ilevel: 850, stats: { +1094 Sta, +1258 Crit, +577 Haste }
Local Finger2 Cursed Warden's Keepsake
ilevel: 865, stats: { +1258 Sta, +1109 Crit, +832 Mastery }, enchant: { +150 Haste }
Local Trinket1 Unstable Horrorslime
ilevel: 860, stats: { +968 Crit }
Local Trinket2 Unstable Arcanocrystal
ilevel: 860, stats: { +807 Vers, +807 Mastery, +807 Crit, +807 Haste }
Local Back Gossamer-Spun Greatcloak
ilevel: 850, stats: { 130 Armor, +729 StrAgiInt, +1094 Sta, +430 Mastery, +304 Crit }
Local Main Hand Xal'atath, Blade of the Black Empire
ilevel: 878, weapon: { 1480 - 2751, 1.8 }, stats: { +722 Int, +1082 Sta, +315 Crit, +303 Mastery, +9183 Int }, relics: { +45 ilevels, +43 ilevels, +40 ilevels }
Local Off Hand Secrets of the Void
ilevel: 878, stats: { +947 Int, +1421 Sta, +564 Haste, +250 Crit }

Talents

Level
15 Twist of Fate (Shadow Priest) Fortress of the Mind (Shadow Priest) Shadow Word: Void (Shadow Priest)
30 Mania (Shadow Priest) Body and Soul Masochism
45 Mind Bomb (Shadow Priest) Psychic Voice Dominant Mind
60 Void Lord (Shadow Priest) Reaper of Souls (Shadow Priest) Void Ray (Shadow Priest)
75 San'layn (Shadow Priest) Auspicious Spirits (Shadow Priest) Shadowy Insight (Shadow Priest)
90 Power Infusion (Shadow Priest) Shadow Crash (Shadow Priest) Mindbender (Shadow Priest)
100 Legacy of the Void (Shadow Priest) Mind Spike (Shadow Priest) Surrender to Madness (Shadow Priest)

Profile

priest="Raji"
origin="https://us.api.battle.net/wow/character/thrall/Raji/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/153/136128921-avatar.jpg"
level=110
race=troll
role=spell
position=back
professions=tailoring=762/enchanting=716
talents=1212231
artifact=47:0:0:0:0:764:1:765:1:766:1:767:3:768:1:771:3:772:2:773:3:774:1:775:3:777:3:778:3:1347:1
spec=shadow

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=flask_of_the_whispered_pact
actions.precombat+=/food,type=azshari_salad
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=deadly_grace
actions.precombat+=/shadowform,if=!buff.shadowform.up
actions.precombat+=/mind_blast

# Executed every time the actor is available.
actions=potion,name=deadly_grace,if=buff.bloodlust.react|target.time_to_die<=40|buff.voidform.stack>80
actions+=/variable,op=set,name=actors_fight_time_mod,value=0
actions+=/variable,op=set,name=actors_fight_time_mod,value=-((-(450)+(time+target.time_to_die))%10),if=time+target.time_to_die>450&time+target.time_to_die<600
actions+=/variable,op=set,name=actors_fight_time_mod,value=((450-(time+target.time_to_die))%5),if=time+target.time_to_die<=450
actions+=/variable,op=set,name=s2mcheck,value=0.8*(45+((raw_haste_pct*100)*(2+(1*talent.reaper_of_souls.enabled)+(2*artifact.mass_hysteria.rank)-(1*talent.sanlayn.enabled))))-(variable.actors_fight_time_mod*nonexecute_actors_pct)
actions+=/variable,op=min,name=s2mcheck,value=180
actions+=/call_action_list,name=s2m,if=buff.voidform.up&buff.surrender_to_madness.up
actions+=/call_action_list,name=vf,if=buff.voidform.up
actions+=/call_action_list,name=main

actions.main=surrender_to_madness,if=talent.surrender_to_madness.enabled&target.time_to_die<=variable.s2mcheck
actions.main+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck+60
actions.main+=/shadow_word_pain,if=dot.shadow_word_pain.remains<(3+(4%3))*gcd
actions.main+=/vampiric_touch,if=dot.vampiric_touch.remains<(4+(4%3))*gcd
actions.main+=/void_eruption,if=insanity>=85|(talent.auspicious_spirits.enabled&insanity>=(80-shadowy_apparitions_in_flight*4))
actions.main+=/shadow_crash,if=talent.shadow_crash.enabled
actions.main+=/mindbender,if=talent.mindbender.enabled&set_bonus.tier18_2pc
actions.main+=/shadow_word_pain,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&talent.legacy_of_the_void.enabled&insanity>=70,cycle_targets=1
actions.main+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=90
actions.main+=/shadow_word_death,if=talent.reaper_of_souls.enabled&cooldown.shadow_word_death.charges=2&insanity<=70
actions.main+=/mind_blast,if=talent.legacy_of_the_void.enabled&(insanity<=81|(insanity<=75.2&talent.fortress_of_the_mind.enabled))
actions.main+=/mind_blast,if=!talent.legacy_of_the_void.enabled|(insanity<=96|(insanity<=95.2&talent.fortress_of_the_mind.enabled))
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.main+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.main+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.main+=/shadow_word_void,if=(insanity<=70&talent.legacy_of_the_void.enabled)|(insanity<=85&!talent.legacy_of_the_void.enabled)
actions.main+=/mind_sear,if=active_enemies>=3,interrupt=1,chain=1
actions.main+=/mind_flay,if=!talent.mind_spike.enabled,interrupt=1,chain=1
actions.main+=/mind_spike,if=talent.mind_spike.enabled
actions.main+=/shadow_word_pain

actions.s2m=shadow_crash,if=talent.shadow_crash.enabled
actions.s2m+=/mindbender,if=talent.mindbender.enabled
actions.s2m+=/dispersion,if=!buff.power_infusion.up&!buff.berserking.up&!buff.bloodlust.up
actions.s2m+=/power_infusion,if=buff.insanity_drain_stacks.stack>=85
actions.s2m+=/berserking,if=buff.voidform.stack>=90
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.s2m+=/void_bolt
actions.s2m+=/void_torrent
actions.s2m+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.s2m+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+90)<100
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.s2m+=/mind_blast
actions.s2m+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.s2m+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.s2m+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.s2m+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+75)<100
actions.s2m+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.s2m+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.s2m+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.s2m+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.s2m+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.s2m+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.s2m+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.s2m+=/mind_spike,if=talent.mind_spike.enabled

actions.vf=surrender_to_madness,if=talent.surrender_to_madness.enabled&insanity>=25&(cooldown.void_bolt.up|cooldown.void_torrent.up|cooldown.shadow_word_death.up|buff.shadowy_insight.up)&target.time_to_die<=variable.s2mcheck-(buff.insanity_drain_stacks.stack)
actions.vf+=/shadow_crash,if=talent.shadow_crash.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&!talent.surrender_to_madness.enabled
actions.vf+=/mindbender,if=talent.mindbender.enabled&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+30
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=30&!talent.surrender_to_madness.enabled
actions.vf+=/power_infusion,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+15
actions.vf+=/berserking,if=buff.voidform.stack>=10&buff.insanity_drain_stacks.stack<=20&!talent.surrender_to_madness.enabled
actions.vf+=/berserking,if=buff.voidform.stack>=10&talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+70
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&dot.vampiric_touch.remains<3.5*gcd&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.vampiric_touch.remains<3.5*gcd&(talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt,if=dot.shadow_word_pain.remains<3.5*gcd&artifact.sphere_of_insanity.rank&target.time_to_die>10,cycle_targets=1
actions.vf+=/void_bolt
actions.vf+=/void_torrent,if=!talent.surrender_to_madness.enabled
actions.vf+=/void_torrent,if=talent.surrender_to_madness.enabled&target.time_to_die>variable.s2mcheck-(buff.insanity_drain_stacks.stack)+60
actions.vf+=/shadow_word_death,if=!talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+10)<100
actions.vf+=/shadow_word_death,if=talent.reaper_of_souls.enabled&current_insanity_drain*gcd.max>insanity&(insanity-(current_insanity_drain*gcd.max)+30)<100
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable_in<gcd.max*0.25
actions.vf+=/mind_blast
actions.vf+=/wait,sec=action.mind_blast.usable_in,if=action.mind_blast.usable_in<gcd.max*0.25
actions.vf+=/shadow_word_death,if=cooldown.shadow_word_death.charges=2
actions.vf+=/shadowfiend,if=!talent.mindbender.enabled,if=buff.voidform.stack>15
actions.vf+=/shadow_word_void,if=(insanity-(current_insanity_drain*gcd.max)+25)<100
actions.vf+=/shadow_word_pain,if=!ticking&(active_enemies<5|talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled|artifact.sphere_of_insanity.rank)
actions.vf+=/vampiric_touch,if=!ticking&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank))
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&(talent.auspicious_spirits.enabled|talent.shadowy_insight.enabled)),cycle_targets=1
actions.vf+=/vampiric_touch,if=!ticking&target.time_to_die>10&(active_enemies<4|talent.sanlayn.enabled|(talent.auspicious_spirits.enabled&artifact.unleash_the_shadows.rank)),cycle_targets=1
actions.vf+=/shadow_word_pain,if=!ticking&target.time_to_die>10&(active_enemies<5&artifact.sphere_of_insanity.rank),cycle_targets=1
actions.vf+=/wait,sec=action.void_bolt.usable_in,if=action.void_bolt.usable|action.void_bolt.usable_in<gcd.max*0.8
actions.vf+=/mind_sear,if=active_enemies>=3,interrupt=1
actions.vf+=/mind_flay,if=!talent.mind_spike.enabled,chain=1,interrupt_immediate=1,interrupt_if=action.void_bolt.usable
actions.vf+=/mind_spike,if=talent.mind_spike.enabled
actions.vf+=/shadow_word_pain

head=hood_of_darkened_visions,id=139189,bonus_id=1807/1808/1482/3336
neck=blackened_portalstone_necklace,id=139332,bonus_id=1807/42/1487/3337
shoulders=ancient_dreamwoven_mantle,id=139191,bonus_id=1807/1477/3336
back=gossamerspun_greatcloak,id=138221,bonus_id=1807/1472
chest=maddening_robe_of_secrets,id=139193,bonus_id=1807/1472
wrists=bracers_of_the_high_priest,id=139762,bonus_id=3386/3384
hands=handwraps_of_delusional_power,id=138212,bonus_id=1807/1808/1477/3336
waist=bonespeaker_cinch,id=134215,bonus_id=3397/1492/1675
legs=legwraps_of_rampant_turmoil,id=137453,bonus_id=1727/1497/3336
feet=norgannons_foresight,id=132455,bonus_id=1811
finger1=twicewarped_azsharan_signet,id=139238,bonus_id=1807/1472
finger2=cursed_wardens_keepsake,id=141546,bonus_id=1477/3336,enchant=150haste
trinket1=unstable_horrorslime,id=138224,bonus_id=1807/1808/1482/3336
trinket2=unstable_arcanocrystal,id=141482,bonus_id=1472
main_hand=xalatath_blade_of_the_black_empire,id=128827,bonus_id=740,gem_id=137347/139257/137377/0,relic_id=1727:1507:3337/1807:1472/1727:1492:1813/0
off_hand=secrets_of_the_void,id=133958

# Gear Summary
# gear_ilvl=858.50
# gear_stamina=20629
# gear_intellect=20529
# gear_crit_rating=10102
# gear_haste_rating=4808
# gear_mastery_rating=5216
# gear_versatility_rating=807
# gear_speed_rating=333
# gear_armor=1654

Vait

Vait : 386350 dps, 271202 dps to main target

  • Race: Undead
  • Class: Rogue
  • Spec: Outlaw
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
386350.3 386350.3 557.6 / 0.144% 110923.7 / 28.7% 13747.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
28.0 28.0 Energy 13.82% 63.2 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Vait/advanced
Talents
  • 15: Ghostly Strike (Outlaw Rogue)
  • 30: Grappling Hook (Outlaw Rogue)
  • 45: Deeper Stratagem
  • 60: Cheat Death
  • 75: Dirty Tricks (Outlaw Rogue)
  • 90: Alacrity
  • 100: Marked for Death
  • Talent Calculator
Artifact
Professions
  • herbalism: 114
  • skinning: 800
Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.58 9.02 7.77 7.14 5.38
Normalized 1.00 0.66 0.57 0.53 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.70 0.70 0.70 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.58, CritRating=7.77, HasteRating=7.14, MasteryRating=5.38, Versatility=9.02 )

Scale Factors for other metrics

Scale Factors for Vait Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 13.58 9.02 7.77 7.14 5.38
Normalized 1.00 0.66 0.57 0.53 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.71 0.70 0.70 0.70 0.69
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit ~= Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.58, CritRating=7.77, HasteRating=7.14, MasteryRating=5.38, Versatility=9.02 )
Scale Factors for Vait Priority Target Damage Per Second
Agi Vers Crit Haste Mastery
Scale Factors 9.61 6.26 5.38 4.81 4.31
Normalized 1.00 0.65 0.56 0.50 0.45
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.37 0.38
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=9.61, CritRating=5.38, HasteRating=4.81, MasteryRating=4.31, Versatility=6.26 )
Scale Factors for Vait Damage Per Second (Effective)
Agi Vers Crit Haste Mastery
Scale Factors 13.58 9.02 7.77 7.14 5.38
Normalized 1.00 0.66 0.57 0.53 0.40
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Agi > Vers > Crit > Haste > Mastery
Pawn string ( Pawn: v1: "Vait": Agility=13.58, CritRating=7.77, HasteRating=7.14, MasteryRating=5.38, Versatility=9.02 )
Scale Factors for Vait Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for Vait Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )
Scale Factors for VaitTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Vait": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Vait 386350
Ambush 2642 0.7% 7.0 64.89sec 150618 149954 Direct 7.0 111667 224048 150622 34.7% 0.0%  

Stats details: ambush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.01 7.01 0.00 0.00 1.0045 0.0000 1055077.48 1551063.83 31.98 149954.16 149954.16
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 4.58 65.34% 111666.64 103906 114297 111310.90 0 114297 511106 751374 31.91
crit 2.43 34.66% 224047.68 207812 228593 210690.69 0 228593 543972 799690 30.07
 
 

Action details: ambush

Static Values
  • id:8676
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:60.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:8676
  • name:Ambush
  • school:physical
  • tooltip:
  • description:Ambush the target, causing $sw2 Physical damage. |cFFFFFFFFAwards {$s3=2} combo $lpoint:points;.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:4.50
 
auto_attack_mh 20249 5.3% 255.9 1.57sec 31693 24842 Direct 255.9 27023 54048 31693 36.3% 19.0%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 255.88 255.88 0.00 0.00 1.2758 0.0000 8109698.34 11922024.74 31.98 24842.39 24842.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 114.57 44.77% 27023.00 24648 27113 27021.89 26711 27113 3096004 4551419 31.98
crit 92.76 36.25% 54048.46 49296 54225 54048.40 53156 54225 5013695 7370606 31.98
miss 48.55 18.97% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
auto_attack_oh 9390 2.4% 237.3 1.69sec 15848 11445 Direct 237.3 13515 27028 15848 36.3% 19.0%  

Stats details: auto_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 237.31 237.31 0.00 0.00 1.3847 0.0000 3760854.52 5528812.38 31.98 11445.29 11445.29
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 106.10 44.71% 13515.28 12324 13556 13514.82 13360 13556 1434035 2108167 31.98
crit 86.09 36.28% 27028.29 24648 27113 27028.47 26514 27113 2326819 3420645 31.98
miss 45.12 19.01% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: auto_attack_oh

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Blade Flurry (_attack) 80995 20.8% 416.4 0.98sec 76790 0 Direct 2081.9 15358 0 15358 0.0% 0.0%  

Stats details: blade_flurry_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 416.37 2081.87 0.00 0.00 0.0000 0.0000 31973351.00 47003854.57 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 2081.87 100.00% 15358.03 4313 80008 15367.59 13143 17968 31973351 47003855 31.98
 
 

Action details: blade_flurry_attack

Static Values
  • id:22482
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:22482
  • name:Blade Flurry
  • school:physical
  • tooltip:
  • description:{$@spelldesc13877=While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:19929.14
  • base_dd_max:19929.14
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
Ghostly Strike 4015 1.0% 27.0 15.07sec 59643 62167 Direct 27.0 43852 87766 59644 36.0% 0.0%  

Stats details: ghostly_strike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.96 26.96 128.86 0.00 0.9594 2.9875 1607958.70 2363851.60 31.98 3914.00 62167.36
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 17.27 64.04% 43851.60 40640 44704 43841.38 42118 44704 757112 1113026 31.98
crit 9.69 35.96% 87766.09 81280 89408 87746.97 81280 89408 850847 1250826 31.98
 
 

Action details: ghostly_strike

Static Values
  • id:196937
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
Spelldata
  • id:196937
  • name:Ghostly Strike
  • school:physical
  • tooltip:Taking {$s5=10}% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take {$s5=10}% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards {$s1=1} combo $lpoint:points;.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.76
 
Greed 33235 (49865) 8.6% (12.8%) 34.7 11.26sec 568695 0 Direct 116.1 83171 166340 113398 36.3% 0.0%  

Stats details: greed

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.73 116.08 0.00 0.00 0.0000 0.0000 13162801.76 19350565.40 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.89 63.66% 83171.39 80816 88897 83203.42 81859 86111 6145349 9034244 31.98
crit 42.19 36.34% 166340.41 161632 177795 166427.80 162642 172691 7017453 10316321 31.98
 
 

Action details: greed

Static Values
  • id:202822
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202822
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
    Greed (_oh) 16630 4.3% 34.7 11.26sec 189686 0 Direct 116.1 41584 83175 56748 36.5% 0.0%  

Stats details: greed_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 34.72 116.07 0.00 0.00 0.0000 0.0000 6586822.14 9683252.47 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 73.75 63.54% 41584.29 40408 44449 41600.65 40940 42832 3066977 4508747 31.98
crit 42.32 36.46% 83174.67 80816 88897 83214.15 81321 86100 3519845 5174505 31.98
 
 

Action details: greed_oh

Static Values
  • id:202823
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:202823
  • name:Greed
  • school:physical
  • tooltip:
  • description:{$@spelldesc202820=Run Through occasionally awakens |cFFFFCC99The Dreadblades|r, unleashing a sweeping attack against all nearby enemies for ${$202822sw2 + $202823sw2} Physical damage, and healing you for ${$MHP*.05} per target hit.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.50
 
Main Gauche 23915 6.2% 240.4 1.69sec 39852 0 Direct 240.4 29247 58495 39852 36.3% 0.0%  

Stats details: main_gauche

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 240.44 240.44 0.00 0.00 0.0000 0.0000 9581955.23 14086381.82 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 153.26 63.74% 29246.80 26671 29338 29245.53 28921 29338 4482289 6589390 31.98
crit 87.18 36.26% 58495.30 53342 58676 58495.33 57293 58676 5099666 7496992 31.98
 
 

Action details: main_gauche

Static Values
  • id:86392
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:86392
  • name:Main Gauche
  • school:physical
  • tooltip:
  • description:A vicious attack that deals $86392sw2 Physical damage with your off-hand.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.10
 
Pistol Shot 7517 2.0% 43.6 8.64sec 69234 71346 Direct 43.6 44890 89773 69235 54.2% 0.0%  

Stats details: pistol_shot

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 43.60 43.60 0.00 0.00 0.9704 0.0000 3018564.46 4437575.68 31.98 71345.68 71345.68
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.95 45.76% 44890.39 40890 44979 44888.77 43616 44979 895626 1316654 31.98
crit 23.65 54.24% 89773.32 81779 89957 89769.16 87621 89957 2122939 3120921 31.98
 
 

Action details: pistol_shot

Static Values
  • id:185763
  • school:physical
  • resource:energy
  • range:20.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.18
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
Spelldata
  • id:185763
  • name:Pistol Shot
  • school:physical
  • tooltip:Movement speed reduced by {$s3=50}%.
  • description:Draw a concealed pistol and fire a quick shot at an enemy, dealing {$s1=0} Physical damage and reducing movement speed by {$s3=50}% for {$d=6 seconds}. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points;.|r
 
Potion of the Old War 11949 3.1% 26.3 5.47sec 179408 0 Direct 26.3 131879 264197 179406 35.9% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 26.29 26.29 0.00 0.00 0.0000 0.0000 4716412.60 6933573.27 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.85 64.08% 131878.98 121121 133233 131861.46 125158 133233 2221607 3265972 31.98
crit 9.44 35.92% 264197.17 242242 266466 264074.17 0 266466 2494806 3667601 31.97
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Run Through 114273 29.7% 99.5 3.98sec 459216 486370 Direct 99.5 336368 672098 459217 36.6% 0.0%  

Stats details: run_through

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 99.50 99.50 0.00 0.00 0.9442 0.0000 45690554.49 67169443.03 31.98 486369.83 486369.83
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 63.09 63.41% 336368.48 258656 387984 336707.52 310452 361640 21221233 31197222 31.98
crit 36.41 36.59% 672098.42 517313 775969 673032.87 617467 729543 24469322 35972221 31.98
 
 

Action details: run_through

Static Values
  • id:2098
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:35.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2098
  • name:Run Through
  • school:physical
  • tooltip:Rooted.
  • description:Lunging finishing move that causes damage per combo point and has increased range: 1 point : ${$m1*1} damage 2 points: ${$m1*2} damage 3 points: ${$m1*3} damage 4 points: ${$m1*4} damage 5 points: ${$m1*5} damage{$?s193531=false}[ 6 points: ${$m1*6} damage][]
 
Saber Slash 58906 15.3% 216.5 1.85sec 109072 168290 Direct 216.5 80090 160184 109072 36.2% 0.0%  

Stats details: saber_slash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 216.46 216.46 0.00 0.00 0.6481 0.0000 23610295.06 34709370.17 31.98 168290.35 168290.35
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 138.14 63.81% 80090.23 73023 80325 80086.35 79216 80325 11063357 16264182 31.98
crit 78.33 36.19% 160184.09 146046 160650 160182.99 157214 160650 12546939 18445188 31.98
 
 

Action details: saber_slash

Static Values
  • id:193315
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:50.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:variable.ss_useable
Spelldata
  • id:193315
  • name:Saber Slash
  • school:physical
  • tooltip:
  • description:Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:2.75
 
Touch of the Grave 2634 0.7% 24.1 16.91sec 43751 0 Direct 24.1 43751 0 43751 0.0% 0.0%  

Stats details: touch_of_the_grave

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.11 24.11 0.00 0.00 0.0000 0.0000 1054747.74 1054747.74 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 24.11 100.00% 43751.35 40074 44082 43747.56 42679 44082 1054748 1054748 0.00
 
 

Action details: touch_of_the_grave

Static Values
  • id:127802
  • school:shadow
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:127802
  • name:Touch of the Grave
  • school:shadow
  • tooltip:
  • description:{$@spelldesc5227=Your attacks and damaging spells have a chance to drain the target, dealing ${$max($AP,$SPH)*$pctD*(1+$@versadmg)} Shadow damage and healing you for the same amount. Additionally, you can breathe underwater indefinitely.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:0.00
  • base_dd_max:0.00
 
Simple Action Stats Execute Interval
Vait
Adrenaline Rush 5.9 71.01sec

Stats details: adrenaline_rush

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.89 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: adrenaline_rush

Static Values
  • id:13750
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:180.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!buff.adrenaline_rush.up&energy.deficit>0
Spelldata
  • id:13750
  • name:Adrenaline Rush
  • school:physical
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Blade Flurry 10.0 29.99sec

Stats details: blade_flurry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: blade_flurry

Static Values
  • id:13877
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:spell_targets.blade_flurry>=2&!buff.blade_flurry.up
Spelldata
  • id:13877
  • name:Blade Flurry
  • school:physical
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
 
Curse of the Dreadblades 4.8 91.85sec

Stats details: curse_of_the_dreadblades

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: curse_of_the_dreadblades

Static Values
  • id:202665
  • school:shadow
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
Spelldata
  • id:202665
  • name:Curse of the Dreadblades
  • school:shadow
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Vait
  • harmful:false
  • if_expr:
 
Gouge 19.9 18.28sec

Stats details: gouge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 19.89 0.00 0.00 0.00 1.0045 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: gouge

Static Values
  • id:1776
  • school:physical
  • resource:energy
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:10.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.dirty_tricks.enabled&combo_points.deficit>=1
Spelldata
  • id:1776
  • name:Gouge
  • school:physical
  • tooltip:Incapacitated.$?$w2!=0[ Damage taken increased by $w2%.][]
  • description:Gouges the eyes of an enemy target, incapacitating for {$d=4 seconds}. Damage will interrupt the effect. |cFFFFFFFFAwards {$s3=1} combo $lpoint:points;.|r
 
Marked for Death 12.7 24.00sec

Stats details: marked_for_death

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 12.74 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: marked_for_death

Static Values
  • id:137619
  • school:physical
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:raid_event.adds.in>40
Spelldata
  • id:137619
  • name:Marked for Death
  • school:physical
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating {$s1=0} combo points. Cooldown reset if the target dies within {$d=60 seconds}.
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Roll the Bones 16.3 24.32sec

Stats details: roll_the_bones

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.29 0.00 0.00 0.00 0.9516 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: roll_the_bones

Static Values
  • id:193316
  • school:physical
  • resource:energy
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:25.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:!talent.slice_and_dice.enabled
Spelldata
  • id:193316
  • name:Roll the Bones
  • school:physical
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
 
Sprint 8.3 49.07sec

Stats details: sprint

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.32 0.00 264.28 0.00 0.0000 0.2500 0.00 0.00 0.00 0.00 0.00
 
 

Action details: sprint

Static Values
  • id:2983
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:equipped.thraxis_tricksy_treads&!variable.ss_useable
Spelldata
  • id:2983
  • name:Sprint
  • school:physical
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:8.00
  • base_tick_time:0.25
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Vanish 6.0 64.69sec

Stats details: vanish

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.02 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: vanish

Static Values
  • id:1856
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:variable.stealth_condition
Spelldata
  • id:1856
  • name:Vanish
  • school:physical
  • tooltip:Improved stealth.
  • description:Allows you to vanish from sight, entering stealth while in combat. For the first {$11327d=3 seconds} after vanishing, damage and harmful effects received will not break stealth. Also breaks movement impairing effects.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Adrenaline Rush 5.9 0.0 71.1sec 71.1sec 21.81% 21.86% 0.0(0.0) 5.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_adrenaline_rush
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • adrenaline_rush_1:21.81%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13750
  • name:Adrenaline Rush
  • tooltip:Energy regeneration increased by {$s1=100}%. Attack speed increased by {$s2=20}%.
  • description:Increases your Energy regeneration rate by {$s1=100}% and your attack speed by {$s2=20}% for {$d=15 seconds}.
  • max_stacks:0
  • duration:15.00
  • cooldown:180.00
  • default_chance:0.00%
Alacrity 1.0 114.8 0.0sec 3.4sec 99.34% 100.00% 98.5(112.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_alacrity
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.01

Stack Uptimes

  • alacrity_1:0.36%
  • alacrity_2:0.31%
  • alacrity_3:0.33%
  • alacrity_4:0.33%
  • alacrity_5:0.34%
  • alacrity_6:0.36%
  • alacrity_7:0.38%
  • alacrity_8:0.43%
  • alacrity_9:0.54%
  • alacrity_10:0.75%
  • alacrity_11:0.92%
  • alacrity_12:0.93%
  • alacrity_13:0.85%
  • alacrity_14:0.78%
  • alacrity_15:0.78%
  • alacrity_16:0.81%
  • alacrity_17:0.85%
  • alacrity_18:0.88%
  • alacrity_19:0.91%
  • alacrity_20:87.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193538
  • name:Alacrity
  • tooltip:Haste increased by $w1%.
  • description:Increases haste by {$s1=1}% for {$d=20 seconds}.
  • max_stacks:20
  • duration:20.00
  • cooldown:0.00
  • default_chance:101.00%
Blade Flurry 10.0 0.0 30.0sec 30.0sec 50.62% 50.62% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blade_flurry
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • blade_flurry_1:50.62%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:13877
  • name:Blade Flurry
  • tooltip:Attacking additional enemies. Energy regeneration reduced by $w1%.$?$w2!=0[ Non-Lethal poison application chance increased by $w2%.][]
  • description:While active, your melee attacks also strike all nearby enemies for {$s3=35}% of normal damage$?s56818[ and the application chance of Non-Lethal poisons is increased by {$s2=0}%][], but your Energy regeneration is reduced by {$s1=20}%. Lasts until cancelled.
  • max_stacks:0
  • duration:-0.00
  • cooldown:10.00
  • default_chance:100.00%
Blood Frenzy 14.2 8.7 28.4sec 17.2sec 45.19% 45.19% 8.7(8.7) 13.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2957.63

Stack Uptimes

  • blood_frenzy_1:45.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 18.20% 0.0(0.0) 1.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Broadsides 4.1 0.0 74.2sec 74.2sec 28.07% 24.78% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_broadsides
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • broadsides_1:28.07%

Trigger Attempt Success

  • trigger_pct:98.88%

Spelldata details

  • id:193356
  • name:Broadsides
  • tooltip:Your attacks generate {$s1=1} additional combo point.
  • description:Your combo-generating abilities generate {$s1=1} additional combo point for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Buried Treasure 4.1 0.0 74.3sec 74.3sec 28.44% 27.41% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_buried_treasure
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • buried_treasure_1:28.44%

Trigger Attempt Success

  • trigger_pct:98.89%

Spelldata details

  • id:199600
  • name:Buried Treasure
  • tooltip:Increases Energy regeneration by {$s1=25}%.
  • description:Your base Energy regeneration is increased by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Curse of the Dreadblades 4.8 0.0 91.9sec 91.9sec 14.19% 14.54% 0.0(0.0) 4.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_curse_of_the_dreadblades
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • curse_of_the_dreadblades_1:14.19%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202665
  • name:Curse of the Dreadblades
  • tooltip:Saber Slash and Pistol Shot will refill all of your combo points when used.
  • description:Invoke the Curse of the Dreadblades, causing each Saber Slash or Pistol Shot to fill your combo points. However, |cFFFFCC99The Dreadblades|r will consume {$202669s1=5}% of your current health when you use a finishing move for the next {$d=12 seconds}.
  • max_stacks:0
  • duration:12.00
  • cooldown:90.00
  • default_chance:101.00%
Grand Melee 4.1 0.0 74.8sec 74.8sec 28.52% 27.48% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_grand_melee
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.67

Stack Uptimes

  • grand_melee_1:28.52%

Trigger Attempt Success

  • trigger_pct:98.89%

Spelldata details

  • id:193358
  • name:Grand Melee
  • tooltip:Attack speed increased by {$s1=50}%. Leech increased by {$s2=25}%.
  • description:Increases your attack speed by {$s1=50}% and your Leech by {$s2=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Hidden Blade 7.0 0.0 58.5sec 64.9sec 4.26% 5.23% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_hidden_blade
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • hidden_blade_1:4.26%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202754
  • name:Hidden Blade
  • tooltip:Your next Saber Slash has 100% chance to strike a second time.
  • description:{$@spelldesc202753=Successfully using Ambush guarantees your next Saber Slash will strike an additional time.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Jolly Roger 4.1 0.0 74.6sec 74.6sec 28.23% 28.08% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_jolly_roger
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • jolly_roger_1:28.23%

Trigger Attempt Success

  • trigger_pct:98.78%

Spelldata details

  • id:199603
  • name:Jolly Roger
  • tooltip:Saber Slash has an additional {$s1=25}% chance of striking an additional time.
  • description:Causes Saber Slash to have an additional {$s1=25}% chance of striking an additional time for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Opportunity 44.6 18.1 8.9sec 6.3sec 37.32% 37.32% 18.1(18.1) 0.7

Buff details

  • buff initial source:Vait
  • cooldown name:buff_opportunity
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • opportunity_1:37.32%

Trigger Attempt Success

  • trigger_pct:41.99%

Spelldata details

  • id:195627
  • name:Opportunity
  • tooltip:Your next Pistol Shot is free.
  • description:{$@spelldesc193315=Viciously slash an enemy, causing ${$sw1*$<mult>} Physical damage. Saber Slash has a {$s5=35}% chance to strike an additional time, making your next Pistol Shot free. |cFFFFFFFFAwards {$s2=1} combo $lpoint:points; each time it strikes.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Potion of the Old War 2.0 0.0 111.0sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.9 1.9 11.9sec 11.3sec 11.96% 11.96% 1.9(1.9) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:11.96%

Trigger Attempt Success

  • trigger_pct:100.00%
Roll the Bones 2.9 13.4 130.1sec 24.4sec 98.82% 98.82% 13.4(13.4) 1.9

Buff details

  • buff initial source:Vait
  • cooldown name:buff_roll_the_bones
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • roll_the_bones_1:98.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:193316
  • name:Roll the Bones
  • tooltip:Gained a random combat enhancement.
  • description:Finishing move that rolls the dice of fate, providing a random combat enhancement. Lasts longer per combo point: 1 point : 12 seconds 2 points: 18 seconds 3 points: 24 seconds 4 points: 30 seconds 5 points: 36 seconds{$?s193531=false}[ 6 points: 42 seconds][]
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shark Infested Waters 4.1 0.0 75.2sec 75.2sec 30.21% 48.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_shark_infested_waters
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.25

Stack Uptimes

  • shark_infested_waters_1:30.21%

Trigger Attempt Success

  • trigger_pct:99.02%

Spelldata details

  • id:193357
  • name:Shark Infested Waters
  • tooltip:Critical Strike chance increased by {$s1=25}%.
  • description:Increases Critical Strike chance by {$s1=25}% for the duration of Roll the Bones.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:0.00%
Sprint 8.3 0.0 49.1sec 49.1sec 16.53% 12.37% 264.3(264.3) 8.2

Buff details

  • buff initial source:Vait
  • cooldown name:buff_sprint
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • sprint_1:16.53%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2983
  • name:Sprint
  • tooltip:Movement speed increased by $w1%.
  • description:Increases your movement speed by {$s1=70}% for {$d=8 seconds}. Usable while stealthed.
  • max_stacks:0
  • duration:8.00
  • cooldown:120.00
  • default_chance:0.00%
Stealth 1.0 0.0 165.1sec 135.1sec 0.00% 0.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_stealth
  • max_stacks:1
  • duration:200.00
  • cooldown:2.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stealth_1:0.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1784
  • name:Stealth
  • tooltip:Stealthed.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:Conceals you in the shadows until cancelled, allowing you to stalk enemies without being seen. {$?s14062=false}[Movement speed while stealthed is increased by {$s3=0}% and damage dealt is increased by {$s4=0}%.]?s108209[ Abilities cost {$112942s1=50}% less while stealthed. ][]{$?s31223=false}[ Attacks from Stealth and for $31666d after deal {$31223s1=10}% more damage.][]
  • max_stacks:0
  • duration:-0.00
  • cooldown:2.00
  • default_chance:100.00%
True Bearing 4.1 0.0 81.6sec 81.6sec 43.77% 43.90% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_true_bearing
  • max_stacks:1
  • duration:0.00
  • cooldown:0.10
  • default_chance:100.00%
  • default_value:2.00

Stack Uptimes

  • true_bearing_1:43.77%

Trigger Attempt Success

  • trigger_pct:99.57%

Spelldata details

  • id:193359
  • name:True Bearing
  • tooltip:Finishers reduce the remaining cooldown on many of your abilities by {$s1=2} sec per combo point.
  • description:For the duration of Roll the Bones, each time you use a finishing move, you reduce the remaining cooldown on Adrenaline Rush, Sprint, Between the Eyes, Vanish, Blind, Cloak of Shadows, Riposte, Grappling Hook, Cannonball Barrage, Killing Spree, Marked for Death, and Death from Above by {$s1=2} sec per combo point spent.
  • max_stacks:0
  • duration:-0.00
  • cooldown:0.00
  • default_chance:100.00%
Vanish 6.0 0.0 64.7sec 64.7sec 0.21% 0.21% 0.0(0.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_vanish
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • vanish_1:0.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:11327
  • name:Vanish
  • tooltip:Improved stealth.$?$w3!=0[ Movement speed increased by $w3%.][]$?$w4!=0[ Damage increased by $w4%.][]
  • description:
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Vait
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Vait
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Vait
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Resources

Resource Usage Type Count Total Average RPE APR
Vait
ambush Energy 7.0 420.3 60.0 60.0 2510.3
ghostly_strike Energy 27.0 808.8 30.0 30.0 1988.1
roll_the_bones Energy 16.3 211.8 13.0 13.0 0.0
roll_the_bones Combo Points 16.3 89.6 5.5 5.5 0.0
run_through Energy 99.5 2288.4 23.0 23.0 19966.1
run_through Combo Points 99.5 570.7 5.7 5.7 80053.9
saber_slash Energy 216.5 7468.0 34.5 34.5 3161.5
Resource Gains Type Count Total Average Overflow
marked_for_death Combo Points 12.74 61.46 (9.26%) 4.82 2.26 3.55%
gouge Combo Points 19.89 19.89 (3.00%) 1.00 0.00 0.00%
ghostly_strike Combo Points 26.96 26.96 (4.06%) 1.00 0.00 0.00%
pistol_shot Combo Points 43.60 43.60 (6.57%) 1.00 0.00 0.00%
saber_slash Combo Points 216.46 200.99 (30.29%) 0.93 15.47 7.15%
adrenaline_rush Energy 310.59 1378.33 (12.38%) 4.44 198.04 12.56%
ambush Combo Points 7.00 14.01 (2.11%) 2.00 0.00 0.02%
energy_regen Energy 1426.19 6926.99 (62.20%) 4.86 237.79 3.32%
combat_potency Energy 179.21 2830.66 (25.42%) 15.80 36.71 1.28%
Broadsides Combo Points 76.65 68.64 (10.34%) 0.90 8.01 10.45%
Ruthlessness Combo Points 115.79 132.09 (19.91%) 1.14 0.00 0.00%
Curse of the Dreadblades Combo Points 27.87 95.94 (14.46%) 3.44 0.00 0.00%
Resource RPS-Gain RPS-Loss
Energy 27.81 27.96
Combo Points 1.66 1.65
Combat End Resource Mean Min Max
Energy 39.22 0.11 100.00
Combo Points 3.25 1.00 6.00

Benefits & Uptimes

Benefits %
Uptimes %
Energy Cap 2.5%

Procs

Count Interval
Roll the Bones: 1 buff 9.7 37.1sec
Roll the Bones: 2 buffs 5.7 64.4sec
Roll the Bones: 3 buffs 0.6 136.2sec
Roll the Bones: 6 buffs 0.3 145.7sec

Statistics & Data Analysis

Fight Length
Sample Data Vait Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Vait Damage Per Second
Count 9999
Mean 386350.31
Minimum 309588.69
Maximum 515591.94
Spread ( max - min ) 206003.25
Range [ ( max - min ) / 2 * 100% ] 26.66%
Standard Deviation 28447.3129
5th Percentile 344293.33
95th Percentile 437209.95
( 95th Percentile - 5th Percentile ) 92916.61
Mean Distribution
Standard Deviation 284.4874
95.00% Confidence Intervall ( 385792.73 - 386907.90 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 208
0.1% Error 20826
0.1 Scale Factor Error with Delta=300 6908220
0.05 Scale Factor Error with Delta=300 27632880
0.01 Scale Factor Error with Delta=300 690822011
Priority Target DPS
Sample Data Vait Priority Target Damage Per Second
Count 9999
Mean 271202.11
Minimum 225152.97
Maximum 348277.28
Spread ( max - min ) 123124.31
Range [ ( max - min ) / 2 * 100% ] 22.70%
Standard Deviation 15357.4411
5th Percentile 248308.97
95th Percentile 298583.25
( 95th Percentile - 5th Percentile ) 50274.28
Mean Distribution
Standard Deviation 153.5821
95.00% Confidence Intervall ( 270901.10 - 271503.13 )
Normalized 95.00% Confidence Intervall ( 99.89% - 100.11% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 123
0.1% Error 12318
0.1 Scale Factor Error with Delta=300 2013359
0.05 Scale Factor Error with Delta=300 8053439
0.01 Scale Factor Error with Delta=300 201335977
DPS(e)
Sample Data Vait Damage Per Second (Effective)
Count 9999
Mean 386350.31
Minimum 309588.69
Maximum 515591.94
Spread ( max - min ) 206003.25
Range [ ( max - min ) / 2 * 100% ] 26.66%
Damage
Sample Data Vait Damage
Count 9999
Mean 153929093.54
Minimum 114025232.64
Maximum 208273343.03
Spread ( max - min ) 94248110.38
Range [ ( max - min ) / 2 * 100% ] 30.61%
DTPS
Sample Data Vait Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Vait Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Vait Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Vait Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Vait Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Vait Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data VaitTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Vait Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,name=flask_of_the_seventh_demon
1 0.00 augmentation,name=defiled
2 0.00 food,name=seedbattered_fish_plate
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 stealth
5 0.00 potion,name=old_war
6 0.00 marked_for_death,if=raid_event.adds.in>40
7 0.00 roll_the_bones,if=!talent.slice_and_dice.enabled
Default action list Executed every time the actor is available.
# count action,conditions
0.00 variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
0.00 variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
Condition to use Saber Slash when not rerolling RtB or when using SnD
0.00 variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
Condition to use Saber Slash, when you have RtB or not
8 0.00 call_action_list,name=bf
Normal rotation
9 0.00 call_action_list,name=cds
A 0.00 call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
Conditions are here to avoid worthless check if nothing is available
0.00 death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
0.00 slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
B 16.29 roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
0.00 killing_spree,if=energy.time_to_max>5|energy<15
C 0.00 call_action_list,name=build
D 0.00 call_action_list,name=finish,if=!variable.ss_useable
E 19.97 gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1
Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions.bf Blade Flurry
# count action,conditions
F 10.00 cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
G 10.00 blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up
actions.build Builders
# count action,conditions
H 26.96 ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
I 43.60 pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
J 149.36 saber_slash,if=variable.ss_useable
actions.cds Cooldowns
# count action,conditions
K 1.00 potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
0.00 blood_fury
0.00 berserking
0.00 arcane_torrent,if=energy.deficit>40
0.00 cannonball_barrage,if=spell_targets.cannonball_barrage>=1
L 5.90 adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
M 12.75 marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
N 8.33 sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
O 4.81 curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)
actions.finish Finishers
# count action,conditions
0.00 between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
P 99.50 run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5
actions.stealth Stealth
# count action,conditions
0.00 variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
Condition to use stealth abilities
Q 7.00 ambush
R 6.02 vanish,if=variable.stealth_condition
0.00 shadowmeld,if=variable.stealth_condition

Sample Sequence

01245QLJHNBOJPJPJPJPJPJPJPJPJHPGIJPJPIHPJPIJPMBJIJFPIJIHPJEJGPMPJJIPEJHNIPJIJPMPFIJJPLKIJHJBRQGJBMPJJPJPJPIHNPMPOJPEJFPIPJPJPIPGLMPJNPJPJPJHPJJPJPMPJBRQFHBIJJIPJJEGJJPJIHJPJJPJIJEJPMPJFJHJENPJJGJIPJJHJPJIJJBMPOIPJFPIPJPIPJPJGIPLJHPJJPJJPJPJPMPJHPJJFPJPJJBJJIGHPJJJJPJIJPMPJHJPFRQIJPJIJJPGIJHJBIJJEBMPJHIJNPOJFPIPJPIPJPJGLPMPRQHJPJJJIJNPJJJJIPMPJFJHJEPJIJBIJIHPJIJPJIJPJIPJHIPJIJPJJEJPJIHPJIJPIJIBRQJNPLEHPJPOIPJPJPJPIPJPJNPJPRQHPIEPJPJJ

Sample Sequence Table

time name target resources buffs
Pre flask Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre augmentation Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre food Vait 100.0/100: 100% energy | 0.0/6: 0% combo_points
Pre stealth Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth
Pre potion Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:00.000 ambush Fluffy_Pillow 100.0/100: 100% energy | 0.0/6: 0% combo_points stealth, potion_of_the_old_war
0:01.003 adrenaline_rush Fluffy_Pillow 59.2/100: 59% energy | 2.0/6: 33% combo_points bloodlust, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.003 saber_slash Fluffy_Pillow 59.2/100: 59% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, hidden_blade, blood_frenzy, potion_of_the_old_war
0:01.806 ghostly_strike Fluffy_Pillow 40.1/100: 40% energy | 4.0/6: 67% combo_points bloodlust, adrenaline_rush, blood_frenzy, potion_of_the_old_war
0:02.611 sprint Fluffy_Pillow 41.0/100: 41% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, blood_frenzy, potion_of_the_old_war
0:02.611 roll_the_bones Fluffy_Pillow 41.0/100: 41% energy | 5.0/6: 83% combo_points bloodlust, adrenaline_rush, sprint, blood_frenzy, potion_of_the_old_war
0:03.415 curse_of_the_dreadblades Fluffy_Pillow 75.1/100: 75% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity, jolly_roger, shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:03.415 saber_slash Fluffy_Pillow 75.1/100: 75% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, sprint, alacrity, jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:04.221 run_through Fluffy_Pillow 72.4/100: 72% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, sprint, alacrity, jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.026 saber_slash Fluffy_Pillow 80.9/100: 81% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, sprint, alacrity(2), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:05.830 run_through Fluffy_Pillow 62.4/100: 62% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(2), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:06.634 saber_slash Fluffy_Pillow 87.2/100: 87% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:07.437 run_through Fluffy_Pillow 68.9/100: 69% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(3), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:08.242 saber_slash Fluffy_Pillow 94.0/100: 94% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.048 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(4), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:09.852 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, sprint, alacrity(6), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:10.655 run_through Fluffy_Pillow 82.7/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(6), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:11.460 saber_slash Fluffy_Pillow 92.7/100: 93% energy | 2.0/6: 33% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:12.264 Waiting 0.800 sec 75.8/100: 76% energy | 6.0/6: 100% combo_points bloodlust, raid_movement, adrenaline_rush, opportunity, alacrity(7), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:13.064 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(7), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:13.868 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:14.671 run_through Fluffy_Pillow 83.3/100: 83% energy | 6.0/6: 100% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(8), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, curse_of_the_dreadblades, blood_frenzy, potion_of_the_old_war
0:15.478 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points bloodlust, adrenaline_rush, opportunity, alacrity(9), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:16.282 run_through Fluffy_Pillow 77.8/100: 78% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(9), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:17.286 saber_slash Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points bloodlust, opportunity, alacrity(10), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, blood_frenzy, potion_of_the_old_war
0:18.292 ghostly_strike Fluffy_Pillow 47.2/100: 47% energy | 3.0/6: 50% combo_points bloodlust, opportunity, alacrity(10), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
0:19.298 run_through Fluffy_Pillow 36.8/100: 37% energy | 5.0/6: 83% combo_points bloodlust, opportunity, alacrity(10), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
0:20.305 blade_flurry Fluffy_Pillow 33.7/100: 34% energy | 1.0/6: 17% combo_points bloodlust, raid_movement, opportunity, alacrity(11), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
0:20.305 pistol_shot Fluffy_Pillow 33.7/100: 34% energy | 1.0/6: 17% combo_points bloodlust, raid_movement, blade_flurry, opportunity, alacrity(11), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
0:21.308 Waiting 1.800 sec 52.1/100: 52% energy | 3.0/6: 50% combo_points bloodlust, raid_movement, blade_flurry, alacrity(11), jolly_roger, shark_infested_waters, broadsides, roll_the_bones, potion_of_the_old_war
0:23.108 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(11), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:24.112 run_through Fluffy_Pillow 68.4/100: 68% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(11), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:25.116 saber_slash Fluffy_Pillow 64.0/100: 64% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(12), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:26.120 run_through Fluffy_Pillow 32.6/100: 33% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(12), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:27.125 pistol_shot Fluffy_Pillow 28.4/100: 28% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(13), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:28.130 Waiting 0.900 sec 47.1/100: 47% energy | 3.0/6: 50% combo_points bloodlust, raid_movement, blade_flurry, alacrity(13), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:29.030 ghostly_strike Fluffy_Pillow 63.9/100: 64% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(13), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:30.035 run_through Fluffy_Pillow 68.7/100: 69% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, alacrity(13), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:31.040 saber_slash Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, alacrity(14), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:32.045 run_through Fluffy_Pillow 49.6/100: 50% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, opportunity, alacrity(14), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:33.048 pistol_shot Fluffy_Pillow 45.6/100: 46% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, opportunity, alacrity(15), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:34.052 saber_slash Fluffy_Pillow 64.7/100: 65% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, alacrity(15), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:35.057 run_through Fluffy_Pillow 49.8/100: 50% energy | 5.0/6: 83% combo_points bloodlust, blade_flurry, alacrity(15), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:36.061 marked_for_death Fluffy_Pillow_Add1 46.1/100: 46% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, alacrity(16), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:36.061 roll_the_bones Fluffy_Pillow 46.1/100: 46% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, alacrity(16), jolly_roger, shark_infested_waters, broadsides, roll_the_bones
0:37.065 saber_slash Fluffy_Pillow 68.5/100: 68% energy | 1.0/6: 17% combo_points bloodlust, blade_flurry, alacrity(17), jolly_roger, true_bearing, roll_the_bones
0:38.069 pistol_shot Fluffy_Pillow 53.9/100: 54% energy | 3.0/6: 50% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, true_bearing, roll_the_bones
0:39.074 saber_slash Fluffy_Pillow 73.3/100: 73% energy | 4.0/6: 67% combo_points bloodlust, blade_flurry, alacrity(17), jolly_roger, true_bearing, roll_the_bones
0:40.079 cancel_buff Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points bloodlust, blade_flurry, opportunity, alacrity(17), jolly_roger, true_bearing, roll_the_bones
0:40.079 run_through Fluffy_Pillow 42.8/100: 43% energy | 6.0/6: 100% combo_points bloodlust, opportunity, alacrity(17), jolly_roger, true_bearing, roll_the_bones
0:41.084 pistol_shot Fluffy_Pillow 37.6/100: 38% energy | 1.0/6: 17% combo_points opportunity, alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:42.088 saber_slash Fluffy_Pillow 53.8/100: 54% energy | 2.0/6: 33% combo_points alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:43.095 pistol_shot Fluffy_Pillow 36.1/100: 36% energy | 4.0/6: 67% combo_points opportunity, alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:44.099 Waiting 0.900 sec 52.2/100: 52% energy | 5.0/6: 83% combo_points raid_movement, alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:44.999 ghostly_strike Fluffy_Pillow 66.8/100: 67% energy | 5.0/6: 83% combo_points alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:46.003 run_through Fluffy_Pillow 85.0/100: 85% energy | 6.0/6: 100% combo_points alacrity(18), jolly_roger, true_bearing, roll_the_bones
0:47.008 saber_slash Fluffy_Pillow 78.3/100: 78% energy | 2.0/6: 33% combo_points alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:48.013 gouge Fluffy_Pillow 44.7/100: 45% energy | 3.0/6: 50% combo_points alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:49.018 saber_slash Fluffy_Pillow 61.0/100: 61% energy | 4.0/6: 67% combo_points alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:50.024 blade_flurry Fluffy_Pillow 43.4/100: 43% energy | 5.0/6: 83% combo_points raid_movement, alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:50.024 Waiting 3.100 sec 43.4/100: 43% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:53.124 run_through Fluffy_Pillow 90.3/100: 90% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(19), jolly_roger, true_bearing, roll_the_bones
0:54.129 marked_for_death Fluffy_Pillow_Add1 82.6/100: 83% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones
0:54.129 run_through Fluffy_Pillow 82.6/100: 83% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones
0:55.132 saber_slash Fluffy_Pillow 74.9/100: 75% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones
0:56.135 Waiting 0.700 sec 40.2/100: 40% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones
0:56.835 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones
0:57.840 pistol_shot Fluffy_Pillow 17.4/100: 17% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
0:58.844 run_through Fluffy_Pillow 50.0/100: 50% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
0:59.849 gouge Fluffy_Pillow 43.5/100: 44% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:00.852 Waiting 0.200 sec 60.1/100: 60% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:01.052 saber_slash Fluffy_Pillow 63.4/100: 63% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:02.057 ghostly_strike Fluffy_Pillow 45.9/100: 46% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:03.063 sprint Fluffy_Pillow 32.5/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:03.063 pistol_shot Fluffy_Pillow 32.5/100: 32% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:04.067 run_through Fluffy_Pillow 65.0/100: 65% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:05.071 saber_slash Fluffy_Pillow 58.6/100: 59% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:06.074 pistol_shot Fluffy_Pillow 25.1/100: 25% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:07.081 Waiting 0.200 sec 41.4/100: 41% energy | 4.0/6: 67% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:07.281 saber_slash Fluffy_Pillow 60.4/100: 60% energy | 4.0/6: 67% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:08.286 run_through Fluffy_Pillow 25.8/100: 26% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:09.291 marked_for_death Fluffy_Pillow_Add1 18.1/100: 18% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:09.291 Waiting 0.451 sec 18.1/100: 18% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:09.742 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:10.748 cancel_buff Fluffy_Pillow 33.3/100: 33% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:10.748 pistol_shot Fluffy_Pillow 33.3/100: 33% energy | 2.0/6: 33% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, roll_the_bones
1:11.751 saber_slash Fluffy_Pillow 67.1/100: 67% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:12.755 saber_slash Fluffy_Pillow 66.9/100: 67% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:13.760 run_through Fluffy_Pillow 50.7/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:14.764 adrenaline_rush Fluffy_Pillow 61.5/100: 61% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:14.764 potion Fluffy_Pillow 61.5/100: 61% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy
1:14.764 pistol_shot Fluffy_Pillow 61.5/100: 61% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:15.568 saber_slash Fluffy_Pillow 90.0/100: 90% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:16.372 Waiting 0.700 sec 68.5/100: 68% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:17.072 ghostly_strike Fluffy_Pillow 93.3/100: 93% energy | 3.0/6: 50% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:17.877 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points adrenaline_rush, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:18.680 roll_the_bones Fluffy_Pillow 94.5/100: 94% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:19.485 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:19.485 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, vanish, alacrity(20), grand_melee, roll_the_bones, blood_frenzy, potion_of_the_old_war
1:20.490 blade_flurry Fluffy_Pillow 75.6/100: 76% energy | 3.0/6: 50% combo_points raid_movement, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
1:20.490 Waiting 2.700 sec 75.6/100: 76% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, hidden_blade, blood_frenzy, potion_of_the_old_war
1:23.190 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, hidden_blade, potion_of_the_old_war
1:23.995 roll_the_bones Fluffy_Pillow 90.6/100: 91% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), grand_melee, roll_the_bones, potion_of_the_old_war
1:24.799 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:24.799 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:25.603 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:26.409 saber_slash Fluffy_Pillow 74.6/100: 75% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:27.213 run_through Fluffy_Pillow 81.1/100: 81% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:28.017 saber_slash Fluffy_Pillow 82.7/100: 83% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:28.824 run_through Fluffy_Pillow 89.3/100: 89% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:29.629 saber_slash Fluffy_Pillow 90.8/100: 91% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:30.435 run_through Fluffy_Pillow 55.2/100: 55% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:31.442 pistol_shot Fluffy_Pillow 47.6/100: 48% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:32.445 Waiting 0.600 sec 62.9/100: 63% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:33.045 ghostly_strike Fluffy_Pillow 72.0/100: 72% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:34.049 sprint Fluffy_Pillow 57.3/100: 57% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:34.049 run_through Fluffy_Pillow 57.3/100: 57% energy | 5.0/6: 83% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:35.053 marked_for_death Fluffy_Pillow_Add1 65.7/100: 66% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:35.053 run_through Fluffy_Pillow 65.7/100: 66% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:36.056 curse_of_the_dreadblades Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, potion_of_the_old_war
1:36.056 saber_slash Fluffy_Pillow 58.0/100: 58% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:37.061 run_through Fluffy_Pillow 23.3/100: 23% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:38.067 gouge Fluffy_Pillow 31.6/100: 32% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:39.071 Waiting 0.200 sec 47.0/100: 47% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:39.271 saber_slash Fluffy_Pillow 50.0/100: 50% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades, potion_of_the_old_war
1:40.276 cancel_buff Fluffy_Pillow 31.3/100: 31% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:40.276 run_through Fluffy_Pillow 31.3/100: 31% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:41.280 pistol_shot Fluffy_Pillow 40.8/100: 41% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:42.283 run_through Fluffy_Pillow 73.3/100: 73% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:43.287 saber_slash Fluffy_Pillow 66.7/100: 67% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:44.292 run_through Fluffy_Pillow 33.2/100: 33% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:45.296 Waiting 0.500 sec 26.7/100: 27% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:45.796 saber_slash Fluffy_Pillow 50.9/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:46.799 run_through Fluffy_Pillow 33.3/100: 33% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:47.804 pistol_shot Fluffy_Pillow 42.8/100: 43% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
1:48.807 Waiting 0.200 sec 59.3/100: 59% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones
1:49.007 run_through Fluffy_Pillow 62.6/100: 63% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones
1:50.013 blade_flurry Fluffy_Pillow 57.4/100: 57% energy | 2.0/6: 33% combo_points raid_movement, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:50.013 adrenaline_rush Fluffy_Pillow 57.4/100: 57% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:50.013 marked_for_death Fluffy_Pillow_Add1 57.4/100: 57% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:50.013 Waiting 3.100 sec 57.4/100: 57% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:53.113 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:53.917 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:54.723 sprint Fluffy_Pillow 76.6/100: 77% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:54.723 run_through Fluffy_Pillow 76.6/100: 77% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:55.529 saber_slash Fluffy_Pillow 96.1/100: 96% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:56.335 run_through Fluffy_Pillow 88.7/100: 89% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:57.138 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:57.942 run_through Fluffy_Pillow 76.5/100: 76% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:58.746 saber_slash Fluffy_Pillow 96.0/100: 96% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
1:59.552 ghostly_strike Fluffy_Pillow 88.5/100: 89% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:00.357 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:01.162 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:01.969 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:02.774 run_through Fluffy_Pillow 76.5/100: 77% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:03.579 saber_slash Fluffy_Pillow 80.0/100: 80% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:04.385 Waiting 0.700 sec 72.6/100: 73% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:05.085 run_through Fluffy_Pillow 94.5/100: 94% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:06.090 marked_for_death Fluffy_Pillow_Add1 88.0/100: 88% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:06.090 run_through Fluffy_Pillow 88.0/100: 88% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:07.094 saber_slash Fluffy_Pillow 81.6/100: 82% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:08.099 roll_the_bones Fluffy_Pillow 64.1/100: 64% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, true_bearing, broadsides, roll_the_bones, blood_frenzy
2:09.103 vanish Fluffy_Pillow 67.7/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, roll_the_bones, blood_frenzy
2:09.103 ambush Fluffy_Pillow 67.7/100: 68% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, vanish, alacrity(20), broadsides, roll_the_bones, blood_frenzy
2:10.107 cancel_buff Fluffy_Pillow 39.5/100: 40% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), broadsides, roll_the_bones, hidden_blade
2:10.107 ghostly_strike Fluffy_Pillow 39.5/100: 40% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, hidden_blade
2:11.112 roll_the_bones Fluffy_Pillow 26.0/100: 26% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, roll_the_bones, hidden_blade
2:12.116 pistol_shot Fluffy_Pillow 49.6/100: 50% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, hidden_blade
2:13.120 saber_slash Fluffy_Pillow 86.2/100: 86% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones, hidden_blade
2:14.126 saber_slash Fluffy_Pillow 72.8/100: 73% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:15.131 pistol_shot Fluffy_Pillow 43.4/100: 43% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:16.137 run_through Fluffy_Pillow 64.1/100: 64% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:17.142 saber_slash Fluffy_Pillow 61.7/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:18.147 saber_slash Fluffy_Pillow 64.3/100: 64% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:19.150 gouge Fluffy_Pillow 34.9/100: 35% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:20.154 blade_flurry Fluffy_Pillow 89.1/100: 89% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:20.154 Waiting 0.400 sec 89.1/100: 89% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:20.554 saber_slash Fluffy_Pillow 97.3/100: 97% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:21.561 saber_slash Fluffy_Pillow 84.1/100: 84% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:22.564 run_through Fluffy_Pillow 86.7/100: 87% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:23.570 saber_slash Fluffy_Pillow 84.4/100: 84% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:24.573 pistol_shot Fluffy_Pillow 55.1/100: 55% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:25.577 ghostly_strike Fluffy_Pillow 91.8/100: 92% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:26.582 saber_slash Fluffy_Pillow 82.5/100: 82% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:27.586 run_through Fluffy_Pillow 85.1/100: 85% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:28.592 saber_slash Fluffy_Pillow 82.9/100: 83% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:29.596 saber_slash Fluffy_Pillow 68.9/100: 69% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:30.601 run_through Fluffy_Pillow 54.0/100: 54% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:31.607 saber_slash Fluffy_Pillow 66.2/100: 66% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:32.612 pistol_shot Fluffy_Pillow 35.4/100: 35% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:33.615 saber_slash Fluffy_Pillow 70.5/100: 71% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:34.620 gouge Fluffy_Pillow 39.7/100: 40% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:35.624 saber_slash Fluffy_Pillow 58.8/100: 59% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:36.629 Waiting 0.400 sec 44.0/100: 44% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:37.029 run_through Fluffy_Pillow 51.6/100: 52% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:38.034 marked_for_death Fluffy_Pillow_Add1 47.8/100: 48% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:38.034 run_through Fluffy_Pillow 47.8/100: 48% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:39.038 saber_slash Fluffy_Pillow 59.9/100: 60% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:40.042 cancel_buff Fluffy_Pillow 45.1/100: 45% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:40.042 Waiting 0.300 sec 45.1/100: 45% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:40.342 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:41.347 Waiting 0.454 sec 21.8/100: 22% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:41.801 ghostly_strike Fluffy_Pillow 31.1/100: 31% energy | 3.0/6: 50% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:42.805 Waiting 1.459 sec 21.7/100: 22% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:44.264 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:45.269 gouge Fluffy_Pillow 38.2/100: 38% energy | 5.0/6: 83% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:46.272 sprint Fluffy_Pillow 58.8/100: 59% energy | 6.0/6: 100% combo_points alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:46.272 run_through Fluffy_Pillow 58.8/100: 59% energy | 6.0/6: 100% combo_points sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:47.277 saber_slash Fluffy_Pillow 56.4/100: 56% energy | 1.0/6: 17% combo_points sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:48.283 Waiting 0.400 sec 43.1/100: 43% energy | 2.0/6: 33% combo_points sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones
2:48.683 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 2.0/6: 33% combo_points sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:49.687 Waiting 0.400 sec 23.9/100: 24% energy | 3.0/6: 50% combo_points sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:50.087 blade_flurry Fluffy_Pillow 32.8/100: 33% energy | 3.0/6: 50% combo_points raid_movement, sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:50.087 Waiting 1.900 sec 32.8/100: 33% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:51.987 saber_slash Fluffy_Pillow 71.9/100: 72% energy | 3.0/6: 50% combo_points blade_flurry, sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:52.992 pistol_shot Fluffy_Pillow 42.6/100: 43% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:53.998 run_through Fluffy_Pillow 79.3/100: 79% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:55.002 saber_slash Fluffy_Pillow 77.0/100: 77% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:56.005 saber_slash Fluffy_Pillow 79.6/100: 80% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:57.009 ghostly_strike Fluffy_Pillow 66.3/100: 66% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:58.015 saber_slash Fluffy_Pillow 73.0/100: 73% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
2:59.020 run_through Fluffy_Pillow 59.7/100: 60% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:00.025 saber_slash Fluffy_Pillow 73.4/100: 73% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:01.029 pistol_shot Fluffy_Pillow 44.1/100: 44% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones, blood_frenzy
3:02.036 saber_slash Fluffy_Pillow 96.8/100: 97% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:03.041 saber_slash Fluffy_Pillow 65.9/100: 66% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:04.046 roll_the_bones Fluffy_Pillow 35.1/100: 35% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), grand_melee, buried_treasure, roll_the_bones
3:05.050 marked_for_death Fluffy_Pillow_Add1 41.2/100: 41% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:05.050 run_through Fluffy_Pillow 41.2/100: 41% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:06.055 curse_of_the_dreadblades Fluffy_Pillow 37.4/100: 37% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:06.056 pistol_shot Fluffy_Pillow 37.4/100: 37% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:07.059 run_through Fluffy_Pillow 56.5/100: 57% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:08.063 Waiting 1.000 sec 68.7/100: 69% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:09.063 saber_slash Fluffy_Pillow 87.8/100: 88% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:10.068 cancel_buff Fluffy_Pillow 56.9/100: 57% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:10.068 run_through Fluffy_Pillow 56.9/100: 57% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:11.072 pistol_shot Fluffy_Pillow 54.5/100: 55% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:12.077 run_through Fluffy_Pillow 91.1/100: 91% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:13.082 saber_slash Fluffy_Pillow 88.7/100: 89% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:14.084 run_through Fluffy_Pillow 59.3/100: 59% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:15.089 pistol_shot Fluffy_Pillow 56.9/100: 57% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:16.093 run_through Fluffy_Pillow 77.5/100: 77% energy | 6.0/6: 100% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:17.097 saber_slash Fluffy_Pillow 75.1/100: 75% energy | 1.0/6: 17% combo_points alacrity(20), broadsides, buried_treasure, roll_the_bones, curse_of_the_dreadblades
3:18.101 run_through Fluffy_Pillow 61.6/100: 62% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:19.106 saber_slash Fluffy_Pillow 59.3/100: 59% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:20.111 blade_flurry Fluffy_Pillow 29.9/100: 30% energy | 3.0/6: 50% combo_points raid_movement, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:20.111 pistol_shot Fluffy_Pillow 29.9/100: 30% energy | 3.0/6: 50% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:21.116 Waiting 2.000 sec 65.0/100: 65% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:23.116 run_through Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:24.121 adrenaline_rush Fluffy_Pillow 96.2/100: 96% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:24.121 Waiting 0.900 sec 96.2/100: 96% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:25.021 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:25.824 ghostly_strike Fluffy_Pillow 80.6/100: 81% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:26.629 run_through Fluffy_Pillow 81.3/100: 81% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:27.432 saber_slash Fluffy_Pillow 89.0/100: 89% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:28.236 saber_slash Fluffy_Pillow 85.6/100: 86% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:29.041 run_through Fluffy_Pillow 82.3/100: 82% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:29.847 saber_slash Fluffy_Pillow 90.1/100: 90% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:30.653 saber_slash Fluffy_Pillow 86.8/100: 87% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:31.457 run_through Fluffy_Pillow 83.5/100: 83% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:32.261 saber_slash Fluffy_Pillow 91.1/100: 91% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:33.065 run_through Fluffy_Pillow 71.8/100: 72% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:33.868 saber_slash Fluffy_Pillow 79.4/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:34.671 run_through Fluffy_Pillow 76.1/100: 76% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:35.475 marked_for_death Fluffy_Pillow_Add1 99.7/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:35.475 run_through Fluffy_Pillow 99.7/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:36.278 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:37.084 ghostly_strike Fluffy_Pillow 96.7/100: 97% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:37.889 run_through Fluffy_Pillow 97.4/100: 97% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:38.694 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:39.498 saber_slash Fluffy_Pillow 89.5/100: 89% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:40.504 cancel_buff Fluffy_Pillow 74.7/100: 75% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:40.504 Waiting 0.500 sec 74.7/100: 75% energy | 5.0/6: 83% combo_points raid_movement, opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:41.004 run_through Fluffy_Pillow 84.9/100: 85% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones
3:42.008 saber_slash Fluffy_Pillow 98.6/100: 99% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:43.014 run_through Fluffy_Pillow 86.9/100: 87% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:44.018 saber_slash Fluffy_Pillow 86.1/100: 86% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:45.023 saber_slash Fluffy_Pillow 58.4/100: 58% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:46.030 roll_the_bones Fluffy_Pillow 46.7/100: 47% energy | 5.0/6: 83% combo_points opportunity, alacrity(20), broadsides, buried_treasure, roll_the_bones, blood_frenzy
3:47.034 saber_slash Fluffy_Pillow 71.9/100: 72% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:48.039 saber_slash Fluffy_Pillow 60.1/100: 60% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:49.043 pistol_shot Fluffy_Pillow 48.4/100: 48% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:50.050 blade_flurry Fluffy_Pillow 86.7/100: 87% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:50.050 Waiting 3.100 sec 86.7/100: 87% energy | 5.0/6: 83% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:53.150 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:54.154 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:55.159 saber_slash Fluffy_Pillow 97.7/100: 98% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:56.164 Waiting 0.900 sec 84.4/100: 84% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:57.064 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:58.069 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
3:59.073 saber_slash Fluffy_Pillow 70.7/100: 71% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:00.078 run_through Fluffy_Pillow 57.4/100: 57% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:01.081 saber_slash Fluffy_Pillow 71.0/100: 71% energy | 2.0/6: 33% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:02.085 pistol_shot Fluffy_Pillow 57.7/100: 58% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:03.090 saber_slash Fluffy_Pillow 78.4/100: 78% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:04.094 run_through Fluffy_Pillow 65.1/100: 65% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:05.098 marked_for_death Fluffy_Pillow_Add1 62.8/100: 63% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:05.098 run_through Fluffy_Pillow 62.8/100: 63% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:06.101 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:07.107 ghostly_strike Fluffy_Pillow 47.1/100: 47% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:08.111 saber_slash Fluffy_Pillow 53.8/100: 54% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:09.115 run_through Fluffy_Pillow 56.5/100: 56% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:10.120 cancel_buff Fluffy_Pillow 70.2/100: 70% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:10.120 vanish Fluffy_Pillow 70.2/100: 70% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:10.120 ambush Fluffy_Pillow 70.2/100: 70% energy | 1.0/6: 17% combo_points opportunity, vanish, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:11.124 pistol_shot Fluffy_Pillow 48.4/100: 48% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, hidden_blade, blood_frenzy
4:12.129 Waiting 0.900 sec 70.7/100: 71% energy | 4.0/6: 67% combo_points raid_movement, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, hidden_blade, blood_frenzy
4:13.029 saber_slash Fluffy_Pillow 90.6/100: 91% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, hidden_blade, blood_frenzy
4:14.032 run_through Fluffy_Pillow 62.8/100: 63% energy | 6.0/6: 100% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:15.036 saber_slash Fluffy_Pillow 78.0/100: 78% energy | 1.0/6: 17% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:16.040 pistol_shot Fluffy_Pillow 50.3/100: 50% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:17.047 saber_slash Fluffy_Pillow 72.6/100: 73% energy | 4.0/6: 67% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:18.052 saber_slash Fluffy_Pillow 60.8/100: 61% energy | 5.0/6: 83% combo_points alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:19.058 run_through Fluffy_Pillow 33.1/100: 33% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:20.062 blade_flurry Fluffy_Pillow 48.3/100: 48% energy | 1.0/6: 17% combo_points raid_movement, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:20.062 pistol_shot Fluffy_Pillow 48.3/100: 48% energy | 1.0/6: 17% combo_points raid_movement, blade_flurry, opportunity, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:21.067 Waiting 2.100 sec 69.0/100: 69% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:23.167 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), shark_infested_waters, buried_treasure, roll_the_bones, blood_frenzy
4:24.171 ghostly_strike Fluffy_Pillow 68.3/100: 68% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), blood_frenzy
4:25.175 saber_slash Fluffy_Pillow 70.3/100: 70% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20)
4:26.180 roll_the_bones Fluffy_Pillow 35.7/100: 36% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, alacrity(20)
4:27.184 pistol_shot Fluffy_Pillow 54.0/100: 54% energy | 1.0/6: 17% combo_points blade_flurry, opportunity, alacrity(20), jolly_roger, roll_the_bones
4:28.188 Waiting 0.900 sec 69.3/100: 69% energy | 2.0/6: 33% combo_points raid_movement, blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:29.088 saber_slash Fluffy_Pillow 83.0/100: 83% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:30.093 saber_slash Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:31.097 gouge Fluffy_Pillow 45.7/100: 46% energy | 4.0/6: 67% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:32.100 roll_the_bones Fluffy_Pillow 61.0/100: 61% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), jolly_roger, roll_the_bones
4:33.104 marked_for_death Fluffy_Pillow_Add1 67.1/100: 67% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:33.104 run_through Fluffy_Pillow 67.1/100: 67% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:34.108 saber_slash Fluffy_Pillow 79.3/100: 79% energy | 1.0/6: 17% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:35.113 ghostly_strike Fluffy_Pillow 64.4/100: 64% energy | 3.0/6: 50% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:36.119 pistol_shot Fluffy_Pillow 53.6/100: 54% energy | 4.0/6: 67% combo_points blade_flurry, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:37.124 saber_slash Fluffy_Pillow 72.8/100: 73% energy | 5.0/6: 83% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:38.129 sprint Fluffy_Pillow 58.0/100: 58% energy | 6.0/6: 100% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:38.129 run_through Fluffy_Pillow 58.0/100: 58% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:39.134 curse_of_the_dreadblades Fluffy_Pillow 54.1/100: 54% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:39.134 saber_slash Fluffy_Pillow 54.1/100: 54% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:40.139 cancel_buff Fluffy_Pillow 39.3/100: 39% energy | 6.0/6: 100% combo_points blade_flurry, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:40.139 run_through Fluffy_Pillow 39.3/100: 39% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:41.143 pistol_shot Fluffy_Pillow 36.9/100: 37% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:42.147 run_through Fluffy_Pillow 57.5/100: 57% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:43.153 saber_slash Fluffy_Pillow 55.1/100: 55% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:44.157 Waiting 0.500 sec 25.7/100: 26% energy | 6.0/6: 100% combo_points raid_movement, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:44.657 run_through Fluffy_Pillow 35.9/100: 36% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:45.662 pistol_shot Fluffy_Pillow 49.5/100: 50% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:46.664 run_through Fluffy_Pillow 70.1/100: 70% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:47.671 saber_slash Fluffy_Pillow 83.7/100: 84% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:48.675 run_through Fluffy_Pillow 54.3/100: 54% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:49.681 saber_slash Fluffy_Pillow 51.9/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:50.686 blade_flurry Fluffy_Pillow 38.6/100: 39% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:50.686 adrenaline_rush Fluffy_Pillow 38.6/100: 39% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:50.686 Waiting 2.500 sec 38.6/100: 39% energy | 6.0/6: 100% combo_points raid_movement, blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, curse_of_the_dreadblades
4:53.186 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones
4:53.990 marked_for_death Fluffy_Pillow_Add1 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:53.990 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:54.793 vanish Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:54.793 ambush Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, vanish, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:55.798 ghostly_strike Fluffy_Pillow 97.4/100: 97% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, hidden_blade, blood_frenzy
4:56.602 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, hidden_blade, blood_frenzy
4:57.407 run_through Fluffy_Pillow 83.2/100: 83% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:58.211 saber_slash Fluffy_Pillow 93.3/100: 93% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:59.016 saber_slash Fluffy_Pillow 76.4/100: 76% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
4:59.820 saber_slash Fluffy_Pillow 59.5/100: 60% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:00.624 pistol_shot Fluffy_Pillow 42.7/100: 43% energy | 4.0/6: 67% combo_points raid_movement, blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:01.428 saber_slash Fluffy_Pillow 91.8/100: 92% energy | 5.0/6: 83% combo_points blade_flurry, adrenaline_rush, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:02.232 sprint Fluffy_Pillow 74.9/100: 75% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:02.232 run_through Fluffy_Pillow 74.9/100: 75% energy | 6.0/6: 100% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:03.036 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 1.0/6: 17% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:03.840 saber_slash Fluffy_Pillow 99.1/100: 99% energy | 2.0/6: 33% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:04.645 saber_slash Fluffy_Pillow 82.3/100: 82% energy | 3.0/6: 50% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:05.448 saber_slash Fluffy_Pillow 81.3/100: 81% energy | 4.0/6: 67% combo_points blade_flurry, adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:06.254 pistol_shot Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points blade_flurry, opportunity, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:07.259 run_through Fluffy_Pillow 73.5/100: 74% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:08.264 marked_for_death Fluffy_Pillow_Add1 87.2/100: 87% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:08.264 run_through Fluffy_Pillow 87.2/100: 87% energy | 6.0/6: 100% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:09.267 saber_slash Fluffy_Pillow 84.9/100: 85% energy | 1.0/6: 17% combo_points blade_flurry, sprint, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:10.271 cancel_buff Fluffy_Pillow 71.6/100: 72% energy | 2.0/6: 33% combo_points blade_flurry, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:10.271 saber_slash Fluffy_Pillow 71.6/100: 72% energy | 2.0/6: 33% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:11.276 ghostly_strike Fluffy_Pillow 59.8/100: 60% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:12.280 saber_slash Fluffy_Pillow 52.1/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:13.284 gouge Fluffy_Pillow 40.3/100: 40% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:14.289 run_through Fluffy_Pillow 62.5/100: 63% energy | 6.0/6: 100% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:15.295 saber_slash Fluffy_Pillow 61.8/100: 62% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:16.300 pistol_shot Fluffy_Pillow 34.1/100: 34% energy | 3.0/6: 50% combo_points raid_movement, opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:17.303 saber_slash Fluffy_Pillow 56.3/100: 56% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:18.307 roll_the_bones Fluffy_Pillow 28.5/100: 29% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), true_bearing, buried_treasure, roll_the_bones, blood_frenzy
5:19.312 pistol_shot Fluffy_Pillow 33.3/100: 33% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:20.318 saber_slash Fluffy_Pillow 51.1/100: 51% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:21.323 pistol_shot Fluffy_Pillow 18.9/100: 19% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:22.328 ghostly_strike Fluffy_Pillow 52.8/100: 53% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:23.332 run_through Fluffy_Pillow 40.5/100: 41% energy | 6.0/6: 100% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:24.335 saber_slash Fluffy_Pillow 51.3/100: 51% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:25.341 pistol_shot Fluffy_Pillow 35.1/100: 35% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:26.347 saber_slash Fluffy_Pillow 68.9/100: 69% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:27.351 run_through Fluffy_Pillow 100.0/100: 100% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:28.356 saber_slash Fluffy_Pillow 94.4/100: 94% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:29.363 pistol_shot Fluffy_Pillow 60.9/100: 61% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:30.368 saber_slash Fluffy_Pillow 77.4/100: 77% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:31.371 run_through Fluffy_Pillow 75.9/100: 76% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:32.375 Waiting 0.700 sec 85.3/100: 85% energy | 2.0/6: 33% combo_points raid_movement, opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:33.075 saber_slash Fluffy_Pillow 96.8/100: 97% energy | 2.0/6: 33% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:34.079 pistol_shot Fluffy_Pillow 63.3/100: 63% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:35.084 run_through Fluffy_Pillow 79.8/100: 80% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:36.089 saber_slash Fluffy_Pillow 89.3/100: 89% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:37.092 ghostly_strike Fluffy_Pillow 55.7/100: 56% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:38.097 pistol_shot Fluffy_Pillow 59.0/100: 59% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:39.101 run_through Fluffy_Pillow 76.8/100: 77% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:40.106 saber_slash Fluffy_Pillow 87.6/100: 88% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:41.113 pistol_shot Fluffy_Pillow 55.4/100: 55% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:42.116 saber_slash Fluffy_Pillow 73.2/100: 73% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:43.120 run_through Fluffy_Pillow 73.0/100: 73% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:44.125 saber_slash Fluffy_Pillow 67.8/100: 68% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:45.130 saber_slash Fluffy_Pillow 51.6/100: 52% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:46.136 gouge Fluffy_Pillow 19.4/100: 19% energy | 3.0/6: 50% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:47.140 saber_slash Fluffy_Pillow 53.2/100: 53% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:48.145 Waiting 0.926 sec 21.0/100: 21% energy | 5.0/6: 83% combo_points raid_movement, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:49.071 run_through Fluffy_Pillow 37.4/100: 37% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:50.075 Waiting 0.200 sec 32.2/100: 32% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:50.275 saber_slash Fluffy_Pillow 51.7/100: 52% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:51.280 pistol_shot Fluffy_Pillow 51.5/100: 52% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:52.285 ghostly_strike Fluffy_Pillow 100.0/100: 100% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:53.288 run_through Fluffy_Pillow 87.8/100: 88% energy | 5.0/6: 83% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:54.294 saber_slash Fluffy_Pillow 82.6/100: 83% energy | 1.0/6: 17% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:55.298 pistol_shot Fluffy_Pillow 50.4/100: 50% energy | 3.0/6: 50% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:56.301 saber_slash Fluffy_Pillow 68.1/100: 68% energy | 4.0/6: 67% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones, blood_frenzy
5:57.305 run_through Fluffy_Pillow 51.4/100: 51% energy | 6.0/6: 100% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:58.309 pistol_shot Fluffy_Pillow 60.9/100: 61% energy | 1.0/6: 17% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
5:59.312 saber_slash Fluffy_Pillow 93.3/100: 93% energy | 2.0/6: 33% combo_points alacrity(20), jolly_roger, grand_melee, roll_the_bones
6:00.316 pistol_shot Fluffy_Pillow 59.8/100: 60% energy | 4.0/6: 67% combo_points opportunity, alacrity(20), jolly_roger, grand_melee, roll_the_bones
6:01.320 roll_the_bones Fluffy_Pillow 76.3/100: 76% energy | 5.0/6: 83% combo_points alacrity(20)
6:02.325 vanish Fluffy_Pillow 95.8/100: 96% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
6:02.325 ambush Fluffy_Pillow 95.8/100: 96% energy | 1.0/6: 17% combo_points vanish, alacrity(20), true_bearing, broadsides, roll_the_bones
6:03.330 saber_slash Fluffy_Pillow 52.2/100: 52% energy | 4.0/6: 67% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:04.333 sprint Fluffy_Pillow 34.7/100: 35% energy | 6.0/6: 100% combo_points raid_movement, alacrity(20), true_bearing, broadsides, roll_the_bones
6:04.333 Waiting 0.400 sec 34.7/100: 35% energy | 6.0/6: 100% combo_points raid_movement, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:04.733 run_through Fluffy_Pillow 41.3/100: 41% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:05.737 adrenaline_rush Fluffy_Pillow 34.7/100: 35% energy | 1.0/6: 17% combo_points sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:05.737 gouge Fluffy_Pillow 34.7/100: 35% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:06.742 ghostly_strike Fluffy_Pillow 67.7/100: 68% energy | 3.0/6: 50% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:07.547 run_through Fluffy_Pillow 64.1/100: 64% energy | 5.0/6: 83% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:08.352 saber_slash Fluffy_Pillow 67.5/100: 68% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:09.158 run_through Fluffy_Pillow 44.0/100: 44% energy | 5.0/6: 83% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:09.963 curse_of_the_dreadblades Fluffy_Pillow 47.4/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:09.963 pistol_shot Fluffy_Pillow 47.4/100: 47% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:10.768 run_through Fluffy_Pillow 73.8/100: 74% energy | 6.0/6: 100% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:11.574 saber_slash Fluffy_Pillow 77.2/100: 77% energy | 1.0/6: 17% combo_points adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:12.379 run_through Fluffy_Pillow 53.6/100: 54% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:13.183 saber_slash Fluffy_Pillow 57.0/100: 57% energy | 2.0/6: 33% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:13.987 run_through Fluffy_Pillow 65.4/100: 65% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:14.792 saber_slash Fluffy_Pillow 84.8/100: 85% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:15.597 run_through Fluffy_Pillow 61.2/100: 61% energy | 6.0/6: 100% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:16.401 pistol_shot Fluffy_Pillow 64.6/100: 65% energy | 1.0/6: 17% combo_points adrenaline_rush, opportunity, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:17.203 run_through Fluffy_Pillow 90.9/100: 91% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:18.008 saber_slash Fluffy_Pillow 94.3/100: 94% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:18.812 run_through Fluffy_Pillow 86.7/100: 87% energy | 6.0/6: 100% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:19.617 saber_slash Fluffy_Pillow 90.1/100: 90% energy | 1.0/6: 17% combo_points adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:20.422 sprint Fluffy_Pillow 82.5/100: 83% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:20.422 Waiting 0.400 sec 82.5/100: 83% energy | 6.0/6: 100% combo_points raid_movement, adrenaline_rush, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:20.822 run_through Fluffy_Pillow 94.3/100: 94% energy | 6.0/6: 100% combo_points sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:21.827 saber_slash Fluffy_Pillow 100.0/100: 100% energy | 2.0/6: 33% combo_points sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, curse_of_the_dreadblades
6:22.832 run_through Fluffy_Pillow 66.5/100: 66% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:23.836 vanish Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:23.836 ambush Fluffy_Pillow 76.0/100: 76% energy | 1.0/6: 17% combo_points opportunity, vanish, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones
6:24.839 ghostly_strike Fluffy_Pillow 32.4/100: 32% energy | 4.0/6: 67% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:25.843 Waiting 0.373 sec 18.9/100: 19% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:26.216 run_through Fluffy_Pillow 25.0/100: 25% energy | 6.0/6: 100% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:27.219 pistol_shot Fluffy_Pillow 18.5/100: 18% energy | 1.0/6: 17% combo_points opportunity, sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:28.223 gouge Fluffy_Pillow 34.9/100: 35% energy | 3.0/6: 50% combo_points sprint, alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:29.228 run_through Fluffy_Pillow 67.4/100: 67% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:30.231 saber_slash Fluffy_Pillow 60.9/100: 61% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones, hidden_blade
6:31.237 run_through Fluffy_Pillow 43.4/100: 43% energy | 5.0/6: 83% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
6:32.241 saber_slash Fluffy_Pillow 52.8/100: 53% energy | 1.0/6: 17% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
6:33.245 Waiting 1.947 sec 19.3/100: 19% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones
6:35.192 saber_slash Fluffy_Pillow 51.2/100: 51% energy | 3.0/6: 50% combo_points alacrity(20), true_bearing, broadsides, roll_the_bones

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 8805 8480 0
Agility 25492 23786 13626 (8132)
Stamina 31123 31123 19786
Intellect 5323 4998 0
Spirit 5 5 0
Health 1867380 1867380 0
Energy 100 100 0
Combo Points 6 6 0
Crit 28.80% 28.80% 4831
Haste 13.92% 13.92% 4524
Damage / Heal Versatility 4.80% 3.86% 1546
Attack Power 38238 35679 0
Mastery 56.72% 56.72% 6223
Armor 2045 2045 2045
Run Speed 8 0 0
Leech 3.42% 3.42% 786

Gear

Source Slot Average Item Level: 855.00
Local Head Magic-Warped Hood
ilevel: 860, stats: { 276 Armor, +2136 Sta, +1424 AgiInt, +939 Mastery, +416 Crit }
Local Neck Brysngamen, Torc of Helheim
ilevel: 845, stats: { +1045 Sta, +1287 Mastery, +514 Vers }, gems: { +150 Vers }
Local Shoulders Biornskin Shoulderpads
ilevel: 830, stats: { 231 Armor, +807 AgiInt, +1211 Sta, +532 Crit, +376 Mastery, +389 Leech }
Local Shirt Rich Purple Silk Shirt
ilevel: 1
Local Chest Scarred Ragefang Chestpiece
ilevel: 850, stats: { 329 Armor, +1945 Sta, +1297 AgiInt, +820 Mastery, +484 Haste }
Local Waist Forest-Lord's Waistwrap
ilevel: 850, stats: { 185 Armor, +1459 Sta, +973 AgiInt, +637 Haste, +342 Mastery }
Local Legs Splotched Bloodfur Leggings
ilevel: 850, stats: { 288 Armor, +1945 Sta, +1297 AgiInt, +932 Crit, +372 Mastery }
Local Feet Thraxi's Tricksy Treads
ilevel: 895, stats: { 263 Armor, +2219 Sta, +1479 Agi, +745 Crit, +413 Mastery }
Local Wrists Biornskin Bracer
ilevel: 840, stats: { 139 Armor, +665 AgiInt, +997 Sta, +479 Crit, +227 Mastery }
Local Hands Dreamsculptor's Gloves
ilevel: 850, stats: { 206 Armor, +1459 Sta, +973 AgiInt, +615 Haste, +363 Crit }
Local Finger1 Dreadful Cyclopean Signet
ilevel: 850, stats: { +1094 Sta, +997 Haste, +839 Mastery }
Local Finger2 Band of Fused Coral
ilevel: 845, stats: { +1045 Sta, +1287 Haste, +514 Crit }
Local Trinket1 An'she's Token of Guile
ilevel: 835, stats: { +1073 Agi, +397 Leech, +882 Vers }
Local Trinket2 Bloodthirsty Instinct
ilevel: 870, stats: { +1486 Agi }
Local Back Goldscar Pelt
ilevel: 845, stats: { 128 Armor, +696 StrAgiInt, +1045 Sta, +216 Crit, +504 Haste }
Local Main Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }, relics: { +43 ilevels, +43 ilevels, +43 ilevels }
Local Off Hand The Dreadblades
ilevel: 879, weapon: { 4318 - 8020, 2.6 }, stats: { +728 Agi, +1093 Sta, +317 Crit, +304 Mastery }

Talents

Level
15 Ghostly Strike (Outlaw Rogue) Swordmaster (Outlaw Rogue) Quick Draw (Outlaw Rogue)
30 Grappling Hook (Outlaw Rogue) Acrobatic Strikes (Outlaw Rogue) Hit and Run (Outlaw Rogue)
45 Deeper Stratagem Anticipation Vigor
60 Iron Stomach (Outlaw Rogue) Elusiveness Cheat Death
75 Parley (Outlaw Rogue) Prey on the Weak Dirty Tricks (Outlaw Rogue)
90 Cannonball Barrage (Outlaw Rogue) Alacrity Killing Spree (Outlaw Rogue)
100 Slice and Dice (Outlaw Rogue) Marked for Death Death from Above

Profile

rogue="Vait"
origin="https://us.api.battle.net/wow/character/thrall/Vait/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/196/133742276-avatar.jpg"
level=110
race=undead
role=attack
position=back
professions=skinning=800/herbalism=114
talents=1113322
artifact=44:0:0:0:0:1052:1:1054:1:1056:1:1057:1:1060:3:1061:3:1063:3:1064:3:1065:1:1066:3:1348:1
spec=outlaw

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,name=flask_of_the_seventh_demon
actions.precombat+=/augmentation,name=defiled
actions.precombat+=/food,name=seedbattered_fish_plate
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/stealth
actions.precombat+=/potion,name=old_war
actions.precombat+=/marked_for_death,if=raid_event.adds.in>40
actions.precombat+=/roll_the_bones,if=!talent.slice_and_dice.enabled

# Executed every time the actor is available.
# Condition to continue rerolling RtB (2- or not TB alone or not SIW alone during CDs); If SnD: consider that you never have to reroll.
actions=variable,name=rtb_reroll,value=!talent.slice_and_dice.enabled&(rtb_buffs<=1&!rtb_list.any.6&((!buff.curse_of_the_dreadblades.up&!buff.adrenaline_rush.up)|!rtb_list.any.5))
# Condition to use Saber Slash when not rerolling RtB or when using SnD
actions+=/variable,name=ss_useable_noreroll,value=(combo_points<5+talent.deeper_stratagem.enabled-(buff.broadsides.up|buff.jolly_roger.up)-(talent.alacrity.enabled&buff.alacrity.stack<=4))
# Condition to use Saber Slash, when you have RtB or not
actions+=/variable,name=ss_useable,value=(talent.anticipation.enabled&combo_points<4)|(!talent.anticipation.enabled&((variable.rtb_reroll&combo_points<4+talent.deeper_stratagem.enabled)|(!variable.rtb_reroll&variable.ss_useable_noreroll)))
# Normal rotation
actions+=/call_action_list,name=bf
actions+=/call_action_list,name=cds
# Conditions are here to avoid worthless check if nothing is available
actions+=/call_action_list,name=stealth,if=stealthed|cooldown.vanish.up|cooldown.shadowmeld.up
actions+=/death_from_above,if=energy.time_to_max>2&!variable.ss_useable_noreroll
actions+=/slice_and_dice,if=!variable.ss_useable&buff.slice_and_dice.remains<target.time_to_die&buff.slice_and_dice.remains<(1+combo_points)*1.8
actions+=/roll_the_bones,if=!variable.ss_useable&buff.roll_the_bones.remains<target.time_to_die&(buff.roll_the_bones.remains<=3|variable.rtb_reroll)
actions+=/killing_spree,if=energy.time_to_max>5|energy<15
actions+=/call_action_list,name=build
actions+=/call_action_list,name=finish,if=!variable.ss_useable
# Gouge is used as a CP Generator while nothing else is available and you have Dirty Tricks talent. It's unlikely that you'll be able to do this optimally in-game since it requires to move in front of the target, but it's here so you can quantifiy its value.
actions+=/gouge,if=talent.dirty_tricks.enabled&combo_points.deficit>=1

# Blade Flurry
actions.bf=cancel_buff,name=blade_flurry,if=equipped.shivarran_symmetry&cooldown.blade_flurry.up&buff.blade_flurry.up&spell_targets.blade_flurry>=2|spell_targets.blade_flurry<2&buff.blade_flurry.up
actions.bf+=/blade_flurry,if=spell_targets.blade_flurry>=2&!buff.blade_flurry.up

# Builders
actions.build=ghostly_strike,if=combo_points.deficit>=1+buff.broadsides.up&!buff.curse_of_the_dreadblades.up&(debuff.ghostly_strike.remains<debuff.ghostly_strike.duration*0.3|(cooldown.curse_of_the_dreadblades.remains<3&debuff.ghostly_strike.remains<14))&(combo_points>=3|(variable.rtb_reroll&time>=10))
actions.build+=/pistol_shot,if=combo_points.deficit>=1+buff.broadsides.up&buff.opportunity.up&energy.time_to_max>2-talent.quick_draw.enabled
actions.build+=/saber_slash,if=variable.ss_useable

# Cooldowns
actions.cds=potion,name=old_war,if=buff.bloodlust.react|target.time_to_die<=25|buff.adrenaline_rush.up
actions.cds+=/blood_fury
actions.cds+=/berserking
actions.cds+=/arcane_torrent,if=energy.deficit>40
actions.cds+=/cannonball_barrage,if=spell_targets.cannonball_barrage>=1
actions.cds+=/adrenaline_rush,if=!buff.adrenaline_rush.up&energy.deficit>0
actions.cds+=/marked_for_death,target_if=min:target.time_to_die,if=target.time_to_die<combo_points.deficit|((raid_event.adds.in>40|buff.true_bearing.remains>15)&combo_points.deficit>=4+talent.deeper_strategem.enabled+talent.anticipation.enabled)
actions.cds+=/sprint,if=equipped.thraxis_tricksy_treads&!variable.ss_useable
actions.cds+=/curse_of_the_dreadblades,if=combo_points.deficit>=4&(!talent.ghostly_strike.enabled|debuff.ghostly_strike.up)

# Finishers
actions.finish=between_the_eyes,if=equipped.greenskins_waterlogged_wristcuffs&buff.shark_infested_waters.up
actions.finish+=/run_through,if=!talent.death_from_above.enabled|energy.time_to_max<cooldown.death_from_above.remains+3.5

# Stealth
# Condition to use stealth abilities
actions.stealth=variable,name=stealth_condition,value=(combo_points.deficit>=2+2*(talent.ghostly_strike.enabled&!debuff.ghostly_strike.up)+buff.broadsides.up&energy>60&!buff.jolly_roger.up&!buff.hidden_blade.up&!buff.curse_of_the_dreadblades.up)
actions.stealth+=/ambush
actions.stealth+=/vanish,if=variable.stealth_condition
actions.stealth+=/shadowmeld,if=variable.stealth_condition

head=magicwarped_hood,id=141453,bonus_id=1472
neck=brysngamen_torc_of_helheim,id=133636,bonus_id=1727/1808/1497/3336,gems=150vers
shoulders=biornskin_shoulderpads,id=134198,bonus_id=3397/41/1492/1675
back=goldscar_pelt,id=133639,bonus_id=1726/1497/3337
chest=scarred_ragefang_chestpiece,id=139208,bonus_id=1807/1472
shirt=rich_purple_silk_shirt,id=4335
wrists=biornskin_bracer,id=134192,bonus_id=3432/1502/3336
hands=dreamsculptors_gloves,id=139202,bonus_id=1807/1472
waist=forestlords_waistwrap,id=139198,bonus_id=1807/1808/1472
legs=splotched_bloodfur_leggings,id=139201,bonus_id=1807/1472
feet=thraxis_tricksy_treads,id=137031,bonus_id=1811
finger1=dreadful_cyclopean_signet,id=139237,bonus_id=1807/1472
finger2=band_of_fused_coral,id=134532,bonus_id=1727/1497/3336
trinket1=anshes_token_of_guile,id=139113,bonus_id=3432/41/607/1497/1674
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1492/3337
main_hand=the_dreadblades,id=128872,bonus_id=742,gem_id=137302/139261/137270/0,relic_id=3410:1502:3336/1807:1472/3410:1502:3336/0
off_hand=the_dreadblades,id=134552

# Gear Summary
# gear_ilvl=854.56
# gear_agility=13626
# gear_stamina=19786
# gear_crit_rating=4831
# gear_haste_rating=4524
# gear_mastery_rating=6223
# gear_versatility_rating=1546
# gear_leech_rating=786
# gear_armor=2045

Bowflexn

Bowflexn : 496574 dps, 349020 dps to main target

  • Race: Tauren
  • Class: Shaman
  • Spec: Enhancement
  • Level: 110
  • Role: Attack
  • Position: back

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
496574.2 496574.2 583.0 / 0.117% 114237.5 / 23.0% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 3.37% 57.8 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced
Talents
  • 15: Boulderfist (Enhancement Shaman)
  • 30: Wind Rush Totem
  • 45: Lightning Surge Totem
  • 60: Hailstorm (Enhancement Shaman)
  • 75: Tempest (Enhancement Shaman)
  • 90: Crashing Storm (Enhancement Shaman)
  • 100: Landslide (Enhancement Shaman)
  • Talent Calculator
Artifact
Professions
  • leatherworking: 800
  • enchanting: 174
Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.98 15.62 13.22 12.09 11.26
Normalized 1.09 1.00 0.85 0.77 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.74 0.74 0.74 0.74 0.74
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.62, CritRating=11.26, HasteRating=13.22, MasteryRating=16.98, Versatility=12.09 )

Scale Factors for other metrics

Scale Factors for Bowflexn Damage Per Second
Mastery Agi Haste Vers Crit
Scale Factors 16.98 15.62 13.22 12.09 11.26
Normalized 1.09 1.00 0.85 0.77 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.74 0.74 0.74 0.74 0.74
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.62, CritRating=11.26, HasteRating=13.22, MasteryRating=16.98, Versatility=12.09 )
Scale Factors for Bowflexn Priority Target Damage Per Second
Agi Mastery Haste Vers Crit
Scale Factors 10.97 10.86 9.62 8.41 7.90
Normalized 1.00 0.99 0.88 0.77 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.38 0.38 0.38 0.38 0.38
Gear Ranking
Optimizers
Ranking
  • Agi ~= Mastery > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=10.97, CritRating=7.90, HasteRating=9.62, MasteryRating=10.86, Versatility=8.41 )
Scale Factors for Bowflexn Damage Per Second (Effective)
Mastery Agi Haste Vers Crit
Scale Factors 16.98 15.62 13.22 12.09 11.26
Normalized 1.09 1.00 0.85 0.77 0.72
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Agi > Haste > Vers > Crit
Pawn string ( Pawn: v1: "Bowflexn": Agility=15.62, CritRating=11.26, HasteRating=13.22, MasteryRating=16.98, Versatility=12.09 )
Scale Factors for Bowflexn Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for Bowflexn Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )
Scale Factors for BowflexnTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Bowflexn": )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% Up%
Bowflexn 496574
Boulderfist 35666 7.2% 77.5 5.19sec 184597 157509 Direct 77.5 138641 282943 184598 31.8% 0.0%  

Stats details: boulderfist

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 77.45 77.45 0.00 0.00 1.1720 0.0000 14297415.79 14297415.79 0.00 157509.10 157509.10
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 52.79 68.15% 138641.14 130665 160356 138637.47 136360 144093 7318333 7318333 0.00
crit 24.67 31.85% 282942.76 266556 327127 282952.64 277218 300553 6979083 6979083 0.00
 
 

Action details: boulderfist

Static Values
  • id:201897
  • school:nature
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
Spelldata
  • id:201897
  • name:Boulderfist
  • school:nature
  • tooltip:
  • description:Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:2.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Crash Lightning 39053 (78020) 7.8% (15.6%) 65.0 6.10sec 475751 408274 Direct 261.5 44398 90573 59149 31.9% 0.0%  

Stats details: crash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 64.95 261.45 0.00 0.00 1.1653 0.0000 15464689.16 15464689.16 0.00 408273.51 408273.51
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 177.93 68.05% 44398.11 39459 51309 44398.29 43747 46016 7899765 7899765 0.00
crit 83.52 31.95% 90573.07 80497 104670 90573.54 89083 94529 7564924 7564924 0.00
 
 

Action details: crash_lightning

Static Values
  • id:187874
  • school:nature
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:artifact.alpha_wolf.rank&prev_gcd.feral_spirit
Spelldata
  • id:187874
  • name:Crash Lightning
  • school:nature
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Crashing Storm 38967 7.8% 403.0 0.98sec 38301 0 Direct 1682.1 6884 14044 9177 32.0% 0.0%  

Stats details: crashing_storm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 403.04 1682.12 0.00 0.00 0.0000 0.0000 15436716.44 15436716.44 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 1143.48 67.98% 6884.16 5997 7949 6884.20 6781 7116 7871928 7871928 0.00
crit 538.64 32.02% 14044.26 12235 16215 14044.45 13835 14566 7564788 7564788 0.00
 
 

Action details: crashing_storm

Static Values
  • id:210801
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210801
  • name:Crashing Storm
  • school:nature
  • tooltip:
  • description:{$@spelldesc192246=Crash Lightning also electrifies the ground, leaving an electrical field behind which damages enemies within it for ${6*{$210801s1=1}} Nature damage over {$210797d=6 seconds}. }
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.140000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Flametongue 6720 (29262) 1.4% (5.9%) 30.3 13.29sec 385480 331236 Direct 30.3 66641 135988 88838 32.0% 0.0%  

Stats details: flametongue

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 30.30 30.30 0.00 0.00 1.1638 0.0000 2692081.66 2692081.66 0.00 331235.62 331235.62
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 20.60 67.99% 66640.93 65856 76972 66642.26 65856 69951 1373078 1373078 0.00
crit 9.70 32.01% 135988.35 134346 157023 135990.00 134346 149464 1319004 1319004 0.00
 
 

Action details: flametongue

Static Values
  • id:193796
  • school:fire
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.flametongue.remains<gcd
Spelldata
  • id:193796
  • name:Flametongue
  • school:fire
  • tooltip:
  • description:Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.200000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
    Flametongue Attack 22543 4.5% 1096.8 1.15sec 8196 0 Direct 1096.8 6149 12544 8196 32.0% 0.0%  

Stats details: flametongue_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1096.76 1096.76 0.00 0.00 0.0000 0.0000 8989273.60 8989273.60 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 745.60 67.98% 6148.66 5355 7097 6148.64 6060 6355 4584466 4584466 0.00
crit 351.16 32.02% 12543.62 10924 14478 12543.61 12365 12895 4404808 4404808 0.00
 
 

Action details: flametongue_attack

Static Values
  • id:10444
  • school:fire
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:10444
  • name:Flametongue Attack
  • school:fire
  • tooltip:
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.125000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Frostbrand 4187 (60014) 0.8% (12.1%) 24.5 16.55sec 976831 832778 Direct 24.5 51349 104762 68424 32.0% 0.0%  

Stats details: frostbrand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.51 24.51 102.27 0.00 1.1730 3.7150 1677099.13 1677099.13 0.00 58584.48 832777.89
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.67 68.03% 51349.45 50764 59333 51349.28 50764 53978 856253 856253 0.00
crit 7.84 31.97% 104762.23 103559 121040 104745.77 0 121040 820846 820846 0.00
 
 

Action details: frostbrand

Static Values
  • id:196834
  • school:frost
  • resource:maelstrom
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:talent.hailstorm.enabled&buff.frostbrand.remains<gcd
Spelldata
  • id:196834
  • name:Frostbrand
  • school:frost
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.925000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:16.00
  • base_tick_time:5.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
    Hailstorm 55827 11.3% 1073.6 1.18sec 20739 0 Direct 1073.6 15557 31739 20738 32.0% 0.0%  

Stats details: hailstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1073.62 1073.62 0.00 0.00 0.0000 0.0000 22265265.09 22265265.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 729.86 67.98% 15557.45 13811 17958 15557.40 15348 15986 11354786 11354786 0.00
crit 343.76 32.02% 31738.96 28174 36635 31739.10 31297 32827 10910479 10910479 0.00
 
 

Action details: hailstorm

Static Values
  • id:210854
  • school:frost
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:210854
  • name:Hailstorm
  • school:frost
  • tooltip:
  • description:{$@spelldesc210853=Frostbrand now also enhances your weapon's damage, causing each of your weapon attacks to also deal $210854sw1 Frost damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.35
 
Lava Lash 6438 (11397) 1.3% (2.3%) 16.8 22.67sec 270289 238106 Direct 16.8 115498 235623 153909 32.0% 0.0%  

Stats details: lava_lash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 16.83 16.83 0.00 0.00 1.1352 0.0000 2589652.96 2589652.96 0.00 238106.05 238106.05
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.45 68.02% 115497.57 114170 133442 115493.37 0 133442 1321922 1321922 0.00
crit 5.38 31.98% 235622.71 232907 272221 233864.19 0 272221 1267731 1267731 0.00
 
 

Action details: lava_lash

Static Values
  • id:60103
  • school:fire
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:30.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:buff.hot_hand.react
Spelldata
  • id:60103
  • name:Lava Lash
  • school:fire
  • tooltip:
  • description:Charges your off-hand weapon with lava and burns your target, dealing $sw1 Fire damage.
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:5.05
 
    Crash Lightning (lava_lash_cl) 4958 1.0% 8.0 29.67sec 244830 0 Direct 33.0 44393 90569 59255 32.2% 0.0%  

Stats details: lava_lash_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 8.00 33.05 0.00 0.00 0.0000 0.0000 1958172.57 1958172.57 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 22.41 67.81% 44392.98 43899 51309 44250.54 0 51309 994857 994857 0.00
crit 10.64 32.19% 90568.82 89554 104670 89537.48 0 104670 963316 963316 0.00
 
 

Action details: lava_lash_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
main_hand 9778 2.0% 166.0 2.42sec 23594 13022 Direct 166.0 20663 42166 23594 32.0% 19.1%  

Stats details: main_hand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 166.03 166.03 0.00 0.00 1.8119 0.0000 3917397.60 5758945.53 31.98 13021.79 13021.79
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.31 48.97% 20662.72 18578 20692 20662.32 20559 20692 1680046 2469827 31.98
crit 53.06 31.96% 42166.11 37899 42211 42165.51 41851 42211 2237351 3289118 31.98
miss 31.67 19.07% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: main_hand

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Mark of the Hidden Satyr 11527 2.3% 24.4 16.31sec 188719 0 Direct 24.4 141550 288920 188719 32.0% 0.0%  

Stats details: mark_of_the_hidden_satyr

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 24.44 24.44 0.00 0.00 0.0000 0.0000 4612820.21 4612820.21 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 16.62 67.99% 141550.16 129428 163883 141544.57 138058 149319 2352477 2352477 0.00
crit 7.82 32.01% 288920.08 264033 334322 288848.78 0 334322 2260343 2260343 0.00
 
 

Action details: mark_of_the_hidden_satyr

Static Values
  • id:191259
  • school:fire
  • resource:none
  • range:40.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:191259
  • name:Mark of the Hidden Satyr
  • school:fire
  • tooltip:
  • description:Deals {$s1=41625 to 48375} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:1.000000
  • base_dd_min:45787.50
  • base_dd_max:53212.50
 
offhand 4878 1.0% 165.5 2.42sec 11813 6503 Direct 165.5 10335 21090 11813 32.0% 19.0%  

Stats details: offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 165.46 165.46 0.00 0.00 1.8165 0.0000 1954647.58 2873517.09 31.98 6503.33 6503.33
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 81.08 49.00% 10335.32 9289 10346 10335.15 10278 10346 837976 1231905 31.98
crit 52.95 32.00% 21089.56 18950 21105 21089.31 20944 21105 1116671 1641612 31.98
miss 31.44 19.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: offhand

Static Values
  • id:1
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Potion of the Old War 8997 1.8% 21.5 7.29sec 165300 0 Direct 21.5 124288 253735 165300 31.7% 0.0%  

Stats details: potion_of_the_old_war

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 21.49 21.49 0.00 0.00 0.0000 0.0000 3551536.20 5221094.63 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.68 68.32% 124287.61 118740 124677 124282.20 122981 124677 1824339 2681952 31.98
crit 6.81 31.68% 253735.03 242230 254342 253606.40 0 254342 1727197 2539143 31.96
 
 

Action details: potion_of_the_old_war

Static Values
  • id:188028
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:188028
  • name:Potion of the Old War
  • school:physical
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:135920.00
  • base_dd_max:203880.00
 
Storm Tempests 4197 0.8% 175.4 1.65sec 9445 0 Direct 175.4 7085 14454 9445 32.0% 0.0%  

Stats details: storm_tempests

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 175.38 175.38 0.00 0.00 0.0000 0.0000 1656567.42 1656567.42 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 119.21 67.97% 7084.73 6286 8183 7084.71 6982 7398 844538 844538 0.00
crit 56.18 32.03% 14454.19 12823 16693 14454.45 14136 15245 812029 812029 0.00
 
 

Action details: storm_tempests

Static Values
  • id:214452
  • school:nature
  • resource:none
  • range:50000.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214452
  • name:Storm Tempests
  • school:nature
  • tooltip:
  • description:{$@spelldesc214260=Enemies hit by your Stormstrike become lightning charged for {$s1=15} sec, zapping a nearby enemy every $214265t1 sec for $214452sw1 Nature damage.}
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.15
 
Stormlash 15606 3.2% 526.2 1.81sec 11870 0 Direct 526.2 11870 0 11870 0.0% 0.0%  

Stats details: stormlash

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 526.21 526.21 0.00 0.00 0.0000 0.0000 6246042.56 6246042.56 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 526.21 100.00% 11869.93 1227 83560 11877.78 10350 13708 6246043 6246043 0.00
 
 

Action details: stormlash

Static Values
  • id:213307
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:213307
  • name:Stormlash
  • school:nature
  • tooltip:
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:1.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:2191.60
  • base_dd_max:2191.60
 
Stormstrike 0 (156340) 0.0% (31.4%) 112.4 3.52sec 552582 474675

Stats details: stormstrike

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 112.45 0.00 0.00 0.00 1.1641 0.0000 0.00 0.00 0.00 474675.06 474675.06
 
 

Action details: stormstrike

Static Values
  • id:17364
  • school:physical
  • resource:maelstrom
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:40.0
  • secondary_cost:0.0
  • cooldown:16.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:active_enemies>=3&!talent.hailstorm.enabled
Spelldata
  • id:17364
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.00
 
    Crash Lightning (stormstrike_cl) 54837 10.9% 81.7 3.58sec 265078 0 Direct 365.1 44475 90724 59282 32.0% 0.0%  

Stats details: stormstrike_cl

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 81.65 365.12 0.00 0.00 0.0000 0.0000 21644762.77 21644762.77 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 248.22 67.98% 44475.03 43899 51309 44474.69 43899 46573 11039815 11039815 0.00
crit 116.89 32.02% 90723.61 89554 104670 90724.86 89554 95384 10604948 10604948 0.00
 
 

Action details: stormstrike_cl

Static Values
  • id:195592
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:195592
  • name:Crash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
    Stormstrike (_mh) 67663 13.7% 140.6 3.52sec 191972 0 Direct 140.6 144049 293516 191971 32.1% 0.0%  

Stats details: stormstrike_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.61 140.61 0.00 0.00 0.0000 0.0000 26993416.48 39682879.11 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.53 67.94% 144049.26 50444 214385 144341.81 125985 164649 13760897 20229821 31.98
crit 45.08 32.06% 293515.66 102905 437345 294052.16 235936 358099 13232520 19453058 31.98
 
 

Action details: stormstrike_mh

Static Values
  • id:32175
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32175
  • name:Stormstrike
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
    Stormstrike Off-Hand 33840 6.8% 140.6 3.52sec 96000 0 Direct 140.6 71992 146898 95998 32.0% 0.0%  

Stats details: stormstrike_offhand

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.61 140.61 0.00 0.00 0.0000 0.0000 13498684.29 19844344.54 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 95.55 67.95% 71992.19 25222 107192 72135.09 62836 81851 6878548 10112117 31.98
crit 45.07 32.05% 146898.08 51452 218673 147182.65 119815 178175 6620136 9732227 31.98
 
 

Action details: stormstrike_offhand

Static Values
  • id:32176
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:32176
  • name:Stormstrike Off-Hand
  • school:physical
  • tooltip:
  • description:{$@spelldesc17364=Energizes both your weapons with lightning and delivers a massive blow to your target, dealing a total of ${$32175sw1+$32176sw1} Physical damage.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:6.00
 
Unleash Lava 9065 1.8% 69.2 8.60sec 52264 0 Direct 68.8 39387 80357 52549 32.1% 0.0%  

Stats details: unleash_lava

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.22 68.85 0.00 0.00 0.0000 0.0000 3617783.54 3617783.54 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.73 67.87% 39387.02 38854 45412 39385.75 38854 42239 1840508 1840508 0.00
crit 22.12 32.13% 80357.25 79261 92640 80361.34 79261 87131 1777275 1777275 0.00
 
 

Action details: unleash_lava

Static Values
  • id:199053
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199053
  • name:Unleash Lava
  • school:fire
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Unleash Lightning 9046 1.8% 69.2 8.62sec 52203 0 Direct 68.8 39383 80337 52485 32.0% 0.0%  

Stats details: unleash_lightning

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 69.16 68.79 0.00 0.00 0.0000 0.0000 3610250.40 3610250.40 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 46.78 68.01% 39382.55 38854 45412 39382.59 38854 42679 1842278 1842278 0.00
crit 22.01 31.99% 80337.33 79261 92640 80337.62 79261 87167 1767973 1767973 0.00
 
 

Action details: unleash_lightning

Static Values
  • id:199054
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:1.2000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:199054
  • name:Unleash Lightning
  • school:nature
  • tooltip:
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.800000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Windfury Attack 22543 4.5% 273.7 3.56sec 32820 0 Direct 273.7 24624 50221 32820 32.0% 0.0%  

Stats details: windfury_attack

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 273.65 273.65 0.00 0.00 0.0000 0.0000 8981115.37 13203090.30 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 186.03 67.98% 24623.54 16793 56048 24628.14 20389 30867 4580635 6733967 31.98
crit 87.62 32.02% 50221.22 34259 114339 50229.52 39202 66698 4400480 6469123 31.98
 
 

Action details: windfury_attack

Static Values
  • id:25504
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:25504
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:{$@spelldesc33757=Each of your main hand attacks has a {$33757h=20}% chance to trigger two extra attacks, dealing $25504sw2 Physical damage each.}
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
Windfury Attack (_oh) 2722 0.6% 29.1 26.83sec 37369 0 Direct 29.1 28024 57169 37369 32.1% 0.0%  

Stats details: windfury_attack_oh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 29.11 29.11 0.00 0.00 0.0000 0.0000 1087928.99 1599358.66 31.98 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 19.78 67.93% 28023.61 25190 28024 28023.64 27646 28024 554250 814800 31.98
crit 9.34 32.07% 57168.83 51388 57169 57157.18 0 57169 533679 784558 31.97
 
 

Action details: windfury_attack_oh

Static Values
  • id:33750
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:33750
  • name:Windfury Attack
  • school:physical
  • tooltip:
  • description:$@spelldesc8232
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:0.80
 
pet - frost_wolf 243948 / 11986
Frozen Bite 88252 0.9% 9.4 35.71sec 185849 0 Direct 9.4 140586 281166 185853 32.2% 0.0%  

Stats details: frozen_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.45 9.45 0.00 0.00 0.0000 0.0000 1755946.79 1755946.79 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.41 67.80% 140586.45 128482 162181 139938.40 0 162181 900626 900626 0.00
crit 3.04 32.20% 281165.83 256963 324361 263320.03 0 324361 855320 855320 0.00
 
 

Action details: frozen_bite

Static Values
  • id:224126
  • school:frost
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224126
  • name:Frozen Bite
  • school:frost
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Bite the target, causing {$s1=1} Frost damage and slowing the target's movement speed by {$s2=50}% for {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.500000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
melee 53168 0.5% 45.6 6.68sec 23180 23126 Direct 45.6 17555 35119 23181 32.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.61 45.61 0.00 0.00 1.0024 0.0000 1057298.71 1554329.25 31.98 23125.52 23125.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.00 67.97% 17555.24 16274 17575 17550.72 0 17575 544268 800126 31.97
crit 14.61 32.03% 35118.55 32547 35151 35073.63 0 35151 513030 754203 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Snowstorm 102528 1.0% 15.6 19.43sec 127192 0 Direct 40.0 37498 74999 49568 32.2% 0.0%  

Stats details: snowstorm

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.58 39.99 0.00 0.00 0.0000 0.0000 1982281.09 1982281.09 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.12 67.82% 37497.66 34261 43248 37369.55 0 43248 1016961 1016961 0.00
crit 12.87 32.18% 74999.06 68523 86495 74143.97 0 86495 965320 965320 0.00
 
 

Action details: snowstorm

Static Values
  • id:198483
  • school:frost
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198483
  • name:Snowstorm
  • school:frost
  • tooltip:
  • description:Deals {$s1=0} Frost damage to all targets within $A1 yards.
 
pet - fiery_wolf 273876 / 14146
Fiery Jaws 125500 1.3% 9.5 36.06sec 272810 0 Direct 9.5 93750 187439 123584 31.8% 0.0%  
Periodic 37.9 37488 0 37488 0.0% 0.0% 9.5%

Stats details: fiery_jaws

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.53 9.53 37.93 37.93 0.0000 1.0000 2599846.38 2599846.38 0.00 68536.05 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 6.50 68.15% 93750.39 85655 108121 93425.81 0 108121 608919 608919 0.00
crit 3.03 31.85% 187439.21 171310 216242 174187.05 0 216242 568838 568838 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 37.9 100.00% 37488.08 34263 43250 37457.10 0 43250 1422089 1422089 0.00
 
 

Action details: fiery_jaws

Static Values
  • id:224125
  • school:fire
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224125
  • name:Fiery Jaws
  • school:fire
  • tooltip:Suffering {$s2=1} Fire damage every $t sec.
  • description:Bite the target for {$s1=1} Fire damage, causing an additional $o2 Fire damage over {$d=4 seconds}.
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.400000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:4.00
  • base_tick_time:1.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Fire Nova 96881 1.0% 15.7 19.58sec 126775 0 Direct 40.3 37491 74991 49552 32.2% 0.0%  

Stats details: fire_nova

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.74 40.27 0.00 0.00 0.0000 0.0000 1995675.67 1995675.67 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 27.32 67.84% 37491.47 34261 43248 37386.75 0 43248 1024280 1024280 0.00
crit 12.95 32.16% 74991.06 68523 86495 74040.07 0 86495 971396 971396 0.00
 
 

Action details: fire_nova

Static Values
  • id:198480
  • school:fire
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198480
  • name:Fire Nova
  • school:fire
  • tooltip:
  • description:Deals {$s1=0} Fire damage to all targets within $A1 yards.
 
melee 51495 0.5% 45.9 6.78sec 23211 23112 Direct 45.9 17555 35119 23211 32.2% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 45.92 45.92 0.00 0.00 1.0043 0.0000 1065933.98 1567023.92 31.98 23112.19 23112.19
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.14 67.80% 17555.27 16274 17575 17551.30 0 17575 546597 803549 31.97
crit 14.79 32.20% 35119.06 32547 35151 35083.61 0 35151 519337 763475 31.94
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
pet - lightning_wolf 187403 / 9150
melee 77425 0.8% 46.7 6.27sec 32418 32440 Direct 46.7 24546 49131 32418 32.0% 0.0%  

Stats details: melee

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 46.71 46.71 0.00 0.00 0.9993 0.0000 1514383.62 2226287.37 31.98 32440.42 32440.42
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 31.76 67.98% 24546.04 16274 26363 24542.49 0 26363 779503 1145944 31.97
crit 14.96 32.02% 49131.06 32547 52726 49081.29 0 52726 734880 1080343 31.95
 
 

Action details: melee

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:1.50
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Thunder Bite 109978 1.1% 15.6 19.30sec 137229 0 Direct 35.2 46133 92215 60890 32.0% 0.0%  

Stats details: thunder_bite

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 15.60 35.17 0.00 0.00 0.0000 0.0000 2141444.36 2141444.36 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 23.91 67.98% 46133.11 24277 64871 46593.85 0 64871 1102921 1102921 0.00
crit 11.26 32.02% 92214.65 48554 129743 92160.00 0 129743 1038524 1038524 0.00
 
 

Action details: thunder_bite

Static Values
  • id:198485
  • school:nature
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198485
  • name:Thunder Bite
  • school:nature
  • tooltip:
  • description:Deals {$s1=0} Nature damage, jumping to up to $x targets.
 
Simple Action Stats Execute Interval
Bowflexn
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
Doom Winds 6.9 62.28sec

Stats details: doom_winds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 6.86 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: doom_winds

Static Values
  • id:204945
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:204945
  • name:Doom Winds
  • school:physical
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
 
Feral Spirit 3.8 120.37sec

Stats details: feral_spirit

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.77 0.00 0.00 0.00 1.2041 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: feral_spirit

Static Values
  • id:51533
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:120.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
Spelldata
  • id:51533
  • name:Feral Spirit
  • school:nature
  • tooltip:
  • description:Summons two Spirit {$?s147783=false}[Raptors][Wolves] that aid you in battle for {$228562d=15 seconds}. They are immune to movement-impairing effects$?a231723[ and grant you {$190185s1=5} Maelstrom each time they attack][].
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Bowflexn
  • harmful:false
  • if_expr:
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Wind Shear 14.4 28.27sec

Stats details: wind_shear

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.39 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: wind_shear

Static Values
  • id:57994
  • school:nature
  • resource:none
  • range:30.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:12.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:57994
  • name:Wind Shear
  • school:nature
  • tooltip:
  • description:Disrupts the target's concentration with a burst of wind, interrupting spellcasting and preventing any spell in that school from being cast for {$d=3 seconds}.
 
pet - lightning_wolf
Crackling Surge 9.5 35.85sec

Stats details: crackling_surge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 9.50 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: crackling_surge

Static Values
  • id:224127
  • school:nature
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:224127
  • name:Crackling Surge
  • school:nature
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Blood Frenzy 14.3 8.5 28.2sec 17.3sec 45.72% 45.72% 8.5(8.5) 13.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_blood_frenzy
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:2743.21

Stack Uptimes

  • blood_frenzy_1:45.72%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:221796
  • name:Blood Frenzy
  • tooltip:Haste increased by {$s1=2498}.
  • description:{$@spelldesc221786=Your ranged and melee attacks have a chance to increase your Haste by {$221796s1=2498} for {$221796d=10 seconds}. This effect occurs more often against targets at low health.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 11.56% 0.0(0.0) 1.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Boulderfist 2.2 75.2 106.0sec 5.2sec 99.49% 98.40% 75.2(75.2) 1.2

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_boulderfist
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • boulderfist_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:218825
  • name:Boulderfist
  • tooltip:Critical strike chance increased by {$s1=5}%. Damage dealt increased by {$s2=5}%.
  • description:{$@spelldesc201897=Slams your target with the power of stone, dealing {$s1=1} Nature damage and enhancing your weapons for {$218825d=10 seconds}, increasing your critical strike chance by {$218825s1=5}% and all damage you deal by {$218825s2=5}%. |cFFFFFFFFGenerates {$s2=25} Maelstrom.|r}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Crash Lightning 10.0 29.3 30.0sec 7.4sec 61.25% 70.17% 29.3(29.3) 10.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_crash_lightning
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • crash_lightning_1:61.25%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187878
  • name:Crash Lightning
  • tooltip:Stormstrike and Lava Lash deal an additional $195592sw1 damage to all targets in front of you.
  • description:{$@spelldesc187874=Electrocutes all enemies in front of you, dealing $sw1 Nature damage. Hitting 2 or more targets enhances your weapons for {$187878d=10 seconds}, causing Stormstrike and Lava Lash to also deal $195592sw1 Nature damage to all targets in front of you. }
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
Dirge of Angerboda 3.8 0.0 79.9sec 79.9sec 7.50% 7.50% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_dirge_of_angerboda
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:4534.14

Stack Uptimes

  • dirge_of_angerboda_1:7.50%

Trigger Attempt Success

  • trigger_pct:98.63%

Spelldata details

  • id:214807
  • name:Dirge of Angerboda
  • tooltip:Mastery increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Doom Winds 6.9 0.0 62.3sec 62.3sec 10.21% 11.98% 0.0(0.0) 6.8

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_doom_winds
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • doom_winds_1:10.21%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:204945
  • name:Doom Winds
  • tooltip:Chance to proc Windfury weapon on auto attacks increased by 100%. Windfury damage increased by {$s2=200}%.
  • description:Unleashes the inner power of the |cFFFFCC99Doomhammer|r, causing all auto attacks to trigger Windfury, and increasing damage dealt by Windfury by {$s2=200}% for {$d=6 seconds}.
  • max_stacks:0
  • duration:6.00
  • cooldown:60.00
  • default_chance:0.00%
Flametongue 4.0 26.3 91.7sec 13.3sec 96.65% 96.61% 45.6(45.6) 3.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flametongue
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • flametongue_1:96.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:194084
  • name:Flametongue
  • tooltip:Each of your weapon attacks causes up to ${$<coeff>*$AP} additional Fire damage.
  • description:{$@spelldesc193796=Scorches your target, dealing {$s2=1} Fire damage, and enhances your weapons with fire for {$194084d=16 seconds}, causing each weapon attack to deal up to ${$<coeff>*$AP} Fire damage, based on weapon speed.}
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Frostbrand 6.7 17.8 55.2sec 16.6sec 95.31% 94.81% 53.4(53.4) 5.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_frostbrand
  • max_stacks:1
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • frostbrand_1:95.31%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196834
  • name:Frostbrand
  • tooltip:Melee attacks reduce target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • description:Chills your target, dealing {$s1=1} Frost damage and reducing the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}, and enhances your weapons with frost for {$d=16 seconds}, causing each weapon attack to reduce the target's movement speed by {$147732s1=50}% for {$147732d=3 seconds}.
  • max_stacks:0
  • duration:16.00
  • cooldown:0.00
  • default_chance:100.00%
Gathering Storms 45.2 19.7 8.8sec 6.1sec 46.64% 40.00% 19.7(19.7) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_gathering_storms
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • gathering_storms_1:46.64%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198300
  • name:Gathering Storms
  • tooltip:Damage of Stormstrike increased by $w1%.
  • description:{$@spelldesc198299=Each target hit by Crash Lightning increases damage dealt by your next Stormstrike within {$198300d=12 seconds} by {$s1=2}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:101.00%
Howl of Ingvar 3.7 0.0 79.9sec 79.8sec 7.42% 7.42% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_howl_of_ingvar
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:crit_rating
  • amount:4534.14

Stack Uptimes

  • howl_of_ingvar_1:7.42%

Trigger Attempt Success

  • trigger_pct:98.48%

Spelldata details

  • id:214802
  • name:Howl of Ingvar
  • tooltip:Critical Strike increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Landslide 2.2 75.2 106.0sec 5.2sec 99.49% 97.77% 75.2(75.2) 1.2

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_landslide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.08

Stack Uptimes

  • landslide_1:99.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202004
  • name:Landslide
  • tooltip:Agility increased by {$s1=8}%.
  • description:{$@spelldesc197992={$?s201897=false}[Boulderfist][Rockbiter] now also enhances your weapon, increasing your Agility by {$202004s1=8}% for {$202004d=10 seconds}.}
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Potion of the Old War 2.0 0.0 121.8sec 0.0sec 12.16% 12.16% 0.0(0.0) 2.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_potion_of_the_old_war
  • max_stacks:1
  • duration:25.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • potion_of_the_old_war_1:12.16%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188028
  • name:Potion of the Old War
  • tooltip:Your melee attacks and abilities are echoed by a pair of fallen warriors.
  • description:Summons a pair of ghostly fallen warriors that will join you in combat. They may echo your melee attacks and abilities, dealing {$233150s1=90523 to 135784} damage.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:101.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Stormbringer 41.0 17.0 9.5sec 6.7sec 34.80% 72.72% 23.5(44.6) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormbringer
  • max_stacks:2
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormbringer_1:14.62%
  • stormbringer_2:20.19%

Trigger Attempt Success

  • trigger_pct:84.58%

Spelldata details

  • id:201846
  • name:Stormbringer
  • tooltip:Stormstrike has no cooldown and its cost is reduced by {$s3=50}%.
  • description:{$@spelldesc201845=Each of your main hand attacks has a {$h=5}% chance to reset the remaining cooldown on Stormstrike, and cause your next Stormstrike to cost {$201846s3=50}% less Maelstrom and trigger no cooldown.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
Stormlash 18.2 11.0 22.3sec 13.7sec 47.10% 47.10% 11.0(11.0) 17.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_stormlash
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • stormlash_1:47.10%

Trigger Attempt Success

  • trigger_pct:99.97%

Spelldata details

  • id:195222
  • name:Stormlash
  • tooltip:Empowered with lightning. Attacks and spellcasts have a chance to deal additional Nature damage.
  • description:{$@spelldesc195255=While your weapons are enhanced, your attacks have a chance to grant Stormlash to up to {$?s210731=false}[${$m1+$210731m1}][{$s1=2}] party or raid members for {$195222d=8 seconds}, causing attacks and spellcasts to deal additional Nature damage.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
Unleash Doom 17.8 10.3 21.8sec 13.6sec 33.14% 40.05% 10.3(10.3) 17.5

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_unleash_doom
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:20.00%
  • default_value:-0.00

Stack Uptimes

  • unleash_doom_1:33.14%

Trigger Attempt Success

  • trigger_pct:19.97%

Spelldata details

  • id:199055
  • name:Unleash Doom
  • tooltip:Your special attacks will trugger an arc of fiery or lightning damage at your target.
  • description:{$@spelldesc198736=Stormstrike has a chance to unleash the power of |cFFFFCC99Doomhammer|r, causing your special attacks to heave molten lava or lightning spikes at your target for {$199053s1=1} Fire or Nature damage.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
Wail of Svala 3.8 0.0 80.3sec 80.3sec 7.44% 7.44% 0.0(0.0) 3.7

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wail_of_svala
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:haste_rating
  • amount:4534.14

Stack Uptimes

  • wail_of_svala_1:7.44%

Trigger Attempt Success

  • trigger_pct:98.52%

Spelldata details

  • id:214803
  • name:Wail of Svala
  • tooltip:Haste increased by $w1.
  • description:{$@spelldesc214798=Your melee attacks have a chance to activate Screams of the Dead, granting you a random combat enhancement for {$214807d=8 seconds}. }
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Wind Strikes 36.3 32.3 10.8sec 5.6sec 35.55% 54.00% 32.3(32.3) 36.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_wind_strikes
  • max_stacks:1
  • duration:3.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.77

Stack Uptimes

  • wind_strikes_1:35.55%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:198293
  • name:Wind Strikes
  • tooltip:Attack speed increased by $w1%.
  • description:{$@spelldesc198292=When Stormbringer resets the remaining cooldown on Stormstrike, you gain {$s1=10}% attack speed for {$198293d=3 seconds}.}
  • max_stacks:0
  • duration:3.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.1 142.7sec 39.1sec 73.47% 73.47% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.47%

Trigger Attempt Success

  • trigger_pct:99.35%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
fiery_wolf: Alpha Wolf 1.7 2.1 142.1sec 39.4sec 73.23% 73.23% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_fiery_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.23%

Trigger Attempt Success

  • trigger_pct:99.20%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.0 141.8sec 39.0sec 73.25% 73.25% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.25%

Trigger Attempt Success

  • trigger_pct:99.15%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
frost_wolf: Alpha Wolf 1.7 2.0 143.4sec 39.1sec 73.22% 73.22% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_frost_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.22%

Trigger Attempt Success

  • trigger_pct:99.27%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.1 143.0sec 38.5sec 73.28% 73.28% 9.8(9.8) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.28%

Trigger Attempt Success

  • trigger_pct:99.14%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Alpha Wolf 1.7 2.1 145.0sec 39.4sec 73.14% 73.14% 9.9(9.9) 0.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_alpha_wolf
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • alpha_wolf_1:73.14%

Trigger Attempt Success

  • trigger_pct:99.19%

Spelldata details

  • id:198486
  • name:Alpha Wolf
  • tooltip:
  • description:{$@spelldesc198434=While Feral Spirits are active, Crash Lightning causes your wolves to attack all nearby enemies for the next {$198486d=8 seconds}.}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.7 0.0 30.2sec 30.2sec 76.34% 68.98% 0.0(0.0) 3.1

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.34%

Trigger Attempt Success

  • trigger_pct:99.83%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
lightning_wolf: Crackling Surge 4.8 0.0 30.6sec 30.6sec 76.29% 68.91% 0.0(0.0) 3.2

Buff details

  • buff initial source:Bowflexn_lightning_wolf
  • cooldown name:buff_crackling_surge
  • max_stacks:1
  • duration:4.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.50

Stack Uptimes

  • crackling_surge_1:76.29%

Trigger Attempt Success

  • trigger_pct:99.79%

Spelldata details

  • id:224127
  • name:Crackling Surge
  • tooltip:Damage dealt increased by {$s1=50}%.
  • description:The Doom Wolf surges with electric energy, increasing all damage dealt by {$s1=50}%.
  • max_stacks:0
  • duration:4.00
  • cooldown:0.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Seventh Demon

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_flask_of_the_seventh_demon
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:1300.00

Stack Uptimes

  • flask_of_the_seventh_demon_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188033
  • name:Flask of the Seventh Demon
  • tooltip:Agility increased by $w1.
  • description:Increases Agility by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (nightborne_delicacy_platter)

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_nightborne_delicacy_platter
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:mastery_rating
  • amount:375.00

Stack Uptimes

  • nightborne_delicacy_platter_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225604
  • name:Well Fed
  • tooltip:Mastery increased by $w1.
  • description:Increases mastery by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Wind Shear16.5950.00136.905218.187143.183315.457
Feral Spirit0.5000.0011.2331.0300.0002.980
Crash Lightning1.5150.00144.39192.34735.931187.552
Boulderfist2.0900.0017.41741.79112.63276.268
Stormstrike2.5420.00120.225326.285162.445511.281
Flametongue4.2210.00144.629117.29657.748191.808
Doom Winds2.6200.00137.80213.6010.67255.085

Resources

Resource Usage Type Count Total Average RPE APR
Bowflexn
crash_lightning Maelstrom 65.0 1299.1 20.0 20.0 23787.5
frostbrand Maelstrom 24.5 490.2 20.0 20.0 48841.3
lava_lash Maelstrom 16.8 504.7 30.0 30.0 9010.2
stormstrike Maelstrom 140.6 2860.4 20.3 25.4 21722.8
Resource Gains Type Count Total Average Overflow
Windfury Attack Maelstrom 302.76 1485.00 (28.48%) 4.90 28.82 1.90%
Main Hand Maelstrom 134.37 666.85 (12.79%) 4.96 4.99 0.74%
Off-Hand Maelstrom 134.03 663.73 (12.73%) 4.95 6.41 0.96%
Feral Spirit Maelstrom 107.76 501.73 (9.62%) 4.66 37.05 6.88%
Boulderfist Maelstrom 77.45 1896.89 (36.38%) 24.49 39.41 2.04%
Resource RPS-Gain RPS-Loss
Maelstrom 13.02 12.87
Combat End Resource Mean Min Max
Mana 220000.00 220000.00 220000.00
Maelstrom 59.89 0.00 150.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
Flametongue: Windfury Attack 295.1 3.6sec
Frostbrand: Windfury Attack 288.6 3.6sec
Maelstrom Weapon: Windfury Attack 302.8 3.5sec
Stormbringer: Windfury Attack 23.2 17.5sec
Flametongue: main_hand 128.3 3.1sec
Frostbrand: main_hand 126.0 3.2sec
Maelstrom Weapon: main_hand 134.4 3.0sec
Stormbringer: main_hand 11.4 32.6sec
Windfury: main_hand 42.7 9.3sec
Flametongue: offhand 128.4 3.1sec
Frostbrand: offhand 126.1 3.2sec
Maelstrom Weapon: offhand 134.0 3.0sec
Windfury: offhand 14.6 26.8sec
Flametongue: Crash Lightning 256.4 6.2sec
Frostbrand: Crash Lightning 250.7 6.3sec
Stormbringer: Crash Lightning 22.1 18.6sec
Windfury: Crash Lightning 61.3 9.9sec
Flametongue: Stormstrike 135.9 3.6sec
Frostbrand: Stormstrike 132.7 3.7sec
Stormbringer: Stormstrike 12.0 30.3sec
Windfury: Stormstrike 32.9 12.4sec
Unleash Doom: Stormstrike 69.2 6.8sec
Flametongue: Stormstrike Off-Hand 135.9 3.6sec
Frostbrand: Stormstrike Off-Hand 132.7 3.7sec
Unleash Doom: Stormstrike Off-Hand 69.2 6.8sec
Flametongue: Lava Lash 16.8 22.7sec
Frostbrand: Lava Lash 16.8 22.7sec

Statistics & Data Analysis

Fight Length
Sample Data Bowflexn Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Bowflexn Damage Per Second
Count 9999
Mean 496574.17
Minimum 411469.93
Maximum 623747.75
Spread ( max - min ) 212277.83
Range [ ( max - min ) / 2 * 100% ] 21.37%
Standard Deviation 29742.2138
5th Percentile 450419.97
95th Percentile 547747.17
( 95th Percentile - 5th Percentile ) 97327.21
Mean Distribution
Standard Deviation 297.4370
95.00% Confidence Intervall ( 495991.21 - 497157.14 )
Normalized 95.00% Confidence Intervall ( 99.88% - 100.12% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 137
0.1% Error 13780
0.1 Scale Factor Error with Delta=300 7551448
0.05 Scale Factor Error with Delta=300 30205792
0.01 Scale Factor Error with Delta=300 755144823
Priority Target DPS
Sample Data Bowflexn Priority Target Damage Per Second
Count 9999
Mean 349019.60
Minimum 299903.29
Maximum 420681.20
Spread ( max - min ) 120777.92
Range [ ( max - min ) / 2 * 100% ] 17.30%
Standard Deviation 15314.6341
5th Percentile 324521.05
95th Percentile 374694.03
( 95th Percentile - 5th Percentile ) 50172.98
Mean Distribution
Standard Deviation 153.1540
95.00% Confidence Intervall ( 348719.42 - 349319.77 )
Normalized 95.00% Confidence Intervall ( 99.91% - 100.09% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 73
0.1% Error 7396
0.1 Scale Factor Error with Delta=300 2002151
0.05 Scale Factor Error with Delta=300 8008605
0.01 Scale Factor Error with Delta=300 200215142
DPS(e)
Sample Data Bowflexn Damage Per Second (Effective)
Count 9999
Mean 496574.17
Minimum 411469.93
Maximum 623747.75
Spread ( max - min ) 212277.83
Range [ ( max - min ) / 2 * 100% ] 21.37%
Damage
Sample Data Bowflexn Damage
Count 9999
Mean 186743319.79
Minimum 145723402.30
Maximum 229057273.50
Spread ( max - min ) 83333871.19
Range [ ( max - min ) / 2 * 100% ] 22.31%
DTPS
Sample Data Bowflexn Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HPS
Sample Data Bowflexn Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Bowflexn Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Bowflexn Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Bowflexn Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Bowflexn Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data BowflexnTheck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Bowflexn Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=seventh_demon
1 0.00 augmentation,type=defiled
2 0.00 food,name=nightborne_delicacy_platter
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=old_war
5 0.00 lightning_shield
Default action list Executed every time the actor is available.
# count action,conditions
6 14.39 wind_shear
0.00 bloodlust,if=target.health.pct<25|time>0.500
Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
7 32.99 auto_attack
8 3.77 feral_spirit
9 1.07 crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
A 1.00 potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
0.00 berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
0.00 blood_fury
B 39.02 crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
C 4.92 boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
D 32.29 boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
0.00 crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
0.00 windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
0.00 windstrike,if=buff.stormbringer.react
E 76.31 stormstrike,if=buff.stormbringer.react
F 10.99 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
G 5.91 flametongue,if=buff.flametongue.remains<gcd
0.00 windsong
0.00 ascendance
0.00 fury_of_air,if=!ticking
H 6.87 doom_winds
0.00 crash_lightning,if=active_enemies>=3
0.00 windstrike
I 36.15 stormstrike
0.00 lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
0.00 lava_lash,if=buff.hot_hand.react
0.00 earthen_spike
J 24.91 crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
K 13.53 frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
L 4.97 flametongue,if=buff.flametongue.remains<4.8
0.00 sundering
M 16.82 lava_lash,if=maelstrom>=90
0.00 rockbiter
N 19.44 flametongue
O 40.31 boulderfist

Sample Sequence

012478D6FGHIDJOMMIEINO7EEIDFJMNOO7BEEEBN7EEBCFIBEINBO6MOJMO7KJINOO7BMOMBN7IKBDHOMBEINJDO67KJON7BEIOBEEN7BEECBFEDEEEDILOKO7B6MOMBN8AIBMO7MBEEDEFHIJLMMC7BEEEBEECBF6ILBO7EEDIEIJDEEEFG7OBEOEBOEEBILOF67BDEEHJDEEILOFO7BO6MNBIIEBCEED7EEFI6DEEGOO7BEK7IB8CEBEEE6BDGK7IHJMDMJNO6O7BIIK7BNMCBEEIBNDMJDK7OJM6INO7BEEEBEK67DBEENBEDEJDHIN7OJFOJONIO6EEK7OJNEOEEJOINJO7KOEEJEN89DK7EDIJN6OMJHMMDJK7IDJNOMJOMOIJE

Sample Sequence Table

time name target resources buffs
Pre flask Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre augmentation Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre food Bowflexn 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom
Pre potion Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:00.000 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom potion_of_the_old_war
0:01.193 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom bloodlust, stormlash, potion_of_the_old_war
0:02.155 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:02.155 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom bloodlust, boulderfist, landslide, stormlash, potion_of_the_old_war
0:03.088 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom bloodlust, frostbrand, boulderfist, landslide, stormlash, blood_frenzy, potion_of_the_old_war
0:03.989 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy, potion_of_the_old_war
0:03.989 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, stormlash, blood_frenzy, potion_of_the_old_war
0:04.891 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
0:05.794 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
0:06.693 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
0:07.592 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
0:08.493 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
0:09.394 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, doom_winds, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
0:10.294 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy, potion_of_the_old_war
0:11.194 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy, potion_of_the_old_war
0:12.093 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:12.994 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:13.894 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:13.894 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
0:14.795 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom bloodlust, flametongue, frostbrand, stormbringer, boulderfist, landslide, blood_frenzy, potion_of_the_old_war
0:15.695 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, blood_frenzy, potion_of_the_old_war
0:16.652 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:17.615 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:18.579 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, potion_of_the_old_war
0:19.542 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:20.507 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:21.470 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:22.434 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, potion_of_the_old_war
0:23.399 Waiting 0.200 sec 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms
0:23.599 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms
0:23.599 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, boulderfist, landslide, gathering_storms
0:24.562 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms
0:25.528 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 135.0/150: 90% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:26.490 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:27.454 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
0:28.418 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
0:29.379 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
0:29.379 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms
0:30.343 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:31.307 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:32.271 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
0:33.235 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash
0:34.198 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom bloodlust, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash
0:35.160 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash
0:36.113 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom bloodlust, flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, wail_of_svala
0:36.978 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
0:37.842 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
0:38.706 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, wail_of_svala
0:39.571 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, wail_of_svala
0:40.435 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, wail_of_svala
0:40.435 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom bloodlust, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, wail_of_svala
0:41.388 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, stormlash, wail_of_svala
0:42.486 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
0:43.543 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
0:44.656 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
0:45.825 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:45.825 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:46.995 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:48.165 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
0:49.335 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
0:50.505 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
0:51.676 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
0:53.058 Waiting 0.600 sec 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
0:53.658 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide
0:53.658 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide
0:54.909 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
0:56.162 Waiting 0.400 sec 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
0:56.562 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
0:58.051 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
0:59.302 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:00.552 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:01.803 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:01.803 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:03.054 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:04.304 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:05.556 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:06.808 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
1:06.808 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
1:08.059 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
1:09.312 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
1:10.563 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, gathering_storms
1:11.815 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, wind_strikes
1:13.066 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
1:14.318 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
1:15.569 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:16.821 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:18.075 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:18.075 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:18.075 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash
1:19.328 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash
1:20.498 Waiting 0.900 sec 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
1:21.398 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
1:22.762 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, blood_frenzy
1:23.971 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, blood_frenzy
1:23.971 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, gathering_storms, blood_frenzy
1:25.161 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
1:26.330 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
1:27.500 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
1:28.667 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
1:29.837 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy
1:31.007 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:32.177 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:33.346 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:33.346 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:34.517 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
1:35.687 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:36.916 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
1:38.168 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, crash_lightning, boulderfist, landslide, stormlash
1:39.420 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
1:40.649 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
1:41.817 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
1:42.987 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
1:44.156 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
1:45.326 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
1:46.495 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
1:47.665 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
1:48.835 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
1:50.005 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
1:51.229 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:52.481 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom
1:53.731 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide
1:53.731 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, boulderfist, landslide
1:54.901 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
1:54.901 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
1:55.958 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
1:57.057 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
1:58.112 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
1:59.167 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
2:00.222 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
2:01.280 potion Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy
2:01.280 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:02.335 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, howl_of_ingvar, wail_of_svala, blood_frenzy, potion_of_the_old_war
2:03.439 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, blood_frenzy, potion_of_the_old_war
2:04.668 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, howl_of_ingvar, potion_of_the_old_war
2:05.919 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, potion_of_the_old_war
2:05.919 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, potion_of_the_old_war
2:07.171 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, potion_of_the_old_war
2:08.340 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy, potion_of_the_old_war
2:09.511 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
2:10.680 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
2:11.850 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 145.0/150: 97% maelstrom flametongue, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy, potion_of_the_old_war
2:13.022 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
2:14.191 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
2:14.191 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, blood_frenzy, potion_of_the_old_war
2:15.360 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, stormlash, blood_frenzy, potion_of_the_old_war
2:16.530 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:17.699 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, unleash_doom, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:18.871 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:20.040 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:21.211 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:21.211 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy, potion_of_the_old_war
2:22.418 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, potion_of_the_old_war
2:23.670 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, potion_of_the_old_war
2:24.892 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy, potion_of_the_old_war
2:26.061 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy, potion_of_the_old_war
2:27.231 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, blood_frenzy
2:28.401 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, blood_frenzy
2:29.572 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
2:30.742 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom, blood_frenzy
2:31.911 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:33.081 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:33.081 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
2:34.251 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:35.421 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:36.590 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, blood_frenzy
2:37.760 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, blood_frenzy
2:37.760 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar, blood_frenzy
2:38.929 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, howl_of_ingvar, blood_frenzy
2:40.149 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, howl_of_ingvar
2:41.401 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, howl_of_ingvar
2:42.653 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
2:43.779 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala
2:44.903 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala
2:46.026 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, wail_of_svala
2:47.149 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, wail_of_svala
2:48.205 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, blood_frenzy
2:49.261 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, wail_of_svala, blood_frenzy
2:50.316 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, wail_of_svala, blood_frenzy
2:51.443 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
2:52.611 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:52.611 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:53.780 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
2:54.948 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy
2:56.118 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
2:57.287 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
2:58.455 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
2:59.624 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
3:00.794 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:01.963 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:03.132 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, blood_frenzy
3:04.337 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
3:05.588 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:06.840 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, crash_lightning, boulderfist, landslide, unleash_doom
3:08.093 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, crash_lightning, boulderfist, landslide, unleash_doom
3:09.345 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:09.345 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:09.345 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
3:10.596 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:11.848 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash
3:13.100 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, stormlash
3:14.351 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash
3:14.351 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, stormlash
3:15.603 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, stormlash
3:16.855 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, doom_winds, wind_strikes, gathering_storms, stormlash
3:18.106 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, doom_winds
3:19.357 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
3:20.609 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:21.863 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:23.113 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:24.364 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide
3:25.615 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide
3:25.615 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide
3:26.784 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
3:27.953 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:27.953 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:29.124 Waiting 0.900 sec 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:30.024 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:31.434 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:32.604 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
3:33.775 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:34.944 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:36.113 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:37.281 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, wind_strikes, gathering_storms, blood_frenzy
3:38.452 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, blood_frenzy
3:39.621 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, blood_frenzy
3:40.789 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, blood_frenzy
3:41.995 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
3:41.995 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
3:43.246 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes
3:44.441 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:45.610 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
3:46.780 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:46.780 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:47.950 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:49.120 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:50.291 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
3:51.460 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, blood_frenzy
3:52.630 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, blood_frenzy
3:53.808 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide
3:53.808 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide
3:55.059 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, gathering_storms
3:56.309 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide
3:57.559 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
3:57.559 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
3:58.809 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:00.060 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, dirge_of_angerboda
4:01.473 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, dirge_of_angerboda
4:02.723 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, gathering_storms, dirge_of_angerboda
4:03.975 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, dirge_of_angerboda
4:05.227 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, dirge_of_angerboda
4:06.480 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, dirge_of_angerboda
4:07.730 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes
4:08.983 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
4:08.983 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom
4:10.234 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
4:11.486 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms
4:12.738 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
4:13.988 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
4:13.988 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
4:15.240 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
4:15.240 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds
4:16.467 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 130.0/150: 87% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
4:17.636 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
4:18.806 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
4:19.976 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
4:21.146 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
4:22.318 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
4:23.487 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:23.487 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:24.656 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:24.656 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 150.0/150: 100% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:25.826 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 140.0/150: 93% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
4:26.996 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 125.0/150: 83% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, dirge_of_angerboda, blood_frenzy
4:28.166 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda, blood_frenzy
4:29.336 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda, blood_frenzy
4:29.336 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, dirge_of_angerboda, blood_frenzy
4:30.507 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, dirge_of_angerboda, blood_frenzy
4:31.648 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, dirge_of_angerboda, blood_frenzy
4:32.705 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, dirge_of_angerboda, blood_frenzy
4:33.760 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, wail_of_svala, dirge_of_angerboda, blood_frenzy
4:34.816 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 120.0/150: 80% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, wail_of_svala, blood_frenzy
4:35.872 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, wail_of_svala, blood_frenzy
4:36.928 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
4:37.984 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wail_of_svala, blood_frenzy
4:39.040 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, wail_of_svala, blood_frenzy
4:40.171 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, gathering_storms, blood_frenzy
4:41.342 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:42.513 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:43.683 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:44.852 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 95.0/150: 63% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:46.020 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:46.020 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:47.189 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms, blood_frenzy
4:48.359 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:49.529 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:49.529 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
4:50.696 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:51.865 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:53.035 Waiting 0.600 sec 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:53.635 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:53.635 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
4:54.804 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, blood_frenzy
4:55.971 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
4:57.139 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
4:58.310 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
4:59.479 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, stormlash, blood_frenzy
5:00.650 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, stormlash, blood_frenzy
5:01.820 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
5:01.820 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
5:01.820 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
5:02.990 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, stormlash, blood_frenzy
5:04.159 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, wind_strikes, gathering_storms, stormlash, howl_of_ingvar, blood_frenzy
5:05.328 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, wind_strikes, stormlash, howl_of_ingvar, blood_frenzy
5:06.495 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, unleash_doom, howl_of_ingvar, blood_frenzy
5:07.664 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar, blood_frenzy
5:08.871 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms, howl_of_ingvar
5:10.122 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, unleash_doom, wind_strikes, howl_of_ingvar
5:11.373 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, stormbringer, crash_lightning, boulderfist, landslide, howl_of_ingvar
5:12.626 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide
5:13.878 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
5:15.128 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, gathering_storms
5:15.240 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds, gathering_storms
5:16.493 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom raid_movement, flametongue, frostbrand, crash_lightning, boulderfist, landslide, doom_winds
5:17.743 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
5:17.743 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
5:18.995 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds
5:20.163 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, blood_frenzy
5:21.332 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:22.501 Waiting 1.000 sec 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:23.501 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:24.828 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:25.996 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:27.165 Waiting 0.600 sec 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:27.765 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:29.091 Waiting 0.100 sec 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:29.191 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:30.528 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:30.528 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, stormlash, blood_frenzy
5:31.698 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, stormlash, blood_frenzy
5:32.868 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, stormlash, blood_frenzy
5:34.038 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:34.038 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 10.0/150: 7% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:35.207 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 35.0/150: 23% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:36.411 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms
5:37.663 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, stormlash
5:38.912 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
5:40.166 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, stormlash
5:41.336 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
5:42.505 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, stormlash, blood_frenzy
5:43.673 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:44.841 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
5:46.009 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:47.177 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 20.0/150: 13% maelstrom flametongue, frostbrand, boulderfist, landslide, blood_frenzy
5:48.347 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 0.0/150: 0% maelstrom raid_movement, flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:49.516 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:49.516 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
5:50.720 Waiting 2.200 sec 220000.0/220000: 100% mana | 5.0/150: 3% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms
5:52.920 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms
5:54.399 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms
5:55.651 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 50.0/150: 33% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, howl_of_ingvar
5:56.901 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, boulderfist, landslide, howl_of_ingvar
5:58.154 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, wind_strikes, gathering_storms, howl_of_ingvar
5:59.407 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, wind_strikes, howl_of_ingvar
6:00.656 feral_spirit Fluffy_Pillow 220000.0/220000: 100% mana | 15.0/150: 10% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, howl_of_ingvar
6:01.905 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 25.0/150: 17% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, howl_of_ingvar
6:03.157 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 30.0/150: 20% maelstrom flametongue, frostbrand, stormbringer, gathering_storms
6:04.410 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom raid_movement, flametongue, frostbrand, stormbringer, boulderfist, landslide, gathering_storms
6:05.662 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, gathering_storms
6:05.662 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, stormbringer, boulderfist, landslide, gathering_storms
6:06.914 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide
6:08.165 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 90.0/150: 60% maelstrom flametongue, frostbrand, boulderfist, landslide
6:09.417 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 60.0/150: 40% maelstrom flametongue, frostbrand, boulderfist, landslide
6:10.622 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 45.0/150: 30% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:11.791 wind_shear Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:11.791 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 55.0/150: 37% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:12.961 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:14.131 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:15.301 doom_winds Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, blood_frenzy
6:15.301 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
6:16.470 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
6:17.638 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 70.0/150: 47% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, blood_frenzy
6:18.808 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar, blood_frenzy
6:19.978 frostbrand Fluffy_Pillow 220000.0/220000: 100% mana | 100.0/150: 67% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar, blood_frenzy
6:21.229 auto_attack Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:21.229 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, doom_winds, gathering_storms, stormlash, howl_of_ingvar
6:22.480 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 40.0/150: 27% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar
6:23.698 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, stormlash, howl_of_ingvar, wail_of_svala
6:24.821 flametongue Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar, wail_of_svala
6:25.905 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, howl_of_ingvar, wail_of_svala, blood_frenzy
6:26.959 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 110.0/150: 73% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
6:28.013 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 85.0/150: 57% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
6:29.068 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, stormlash, wail_of_svala, blood_frenzy
6:30.124 lava_lash Fluffy_Pillow 220000.0/220000: 100% mana | 105.0/150: 70% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
6:31.179 Waiting 0.300 sec 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, wail_of_svala, blood_frenzy
6:31.479 boulderfist Fluffy_Pillow 220000.0/220000: 100% mana | 80.0/150: 53% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:32.874 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 115.0/150: 77% maelstrom flametongue, frostbrand, boulderfist, landslide, gathering_storms, blood_frenzy
6:34.233 crash_lightning Fluffy_Pillow 220000.0/220000: 100% mana | 75.0/150: 50% maelstrom flametongue, frostbrand, boulderfist, landslide, unleash_doom, blood_frenzy
6:35.408 stormstrike Fluffy_Pillow 220000.0/220000: 100% mana | 65.0/150: 43% maelstrom flametongue, frostbrand, stormbringer(2), boulderfist, landslide, unleash_doom, wind_strikes, gathering_storms

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 4726 4401 0
Agility 27166 25460 15220 (12075)
Stamina 37037 37037 21970
Intellect 7651 7326 0
Spirit 0 0 0
Health 2222220 2222220 0
Mana 220000 220000 0
Maelstrom 150 150 0
Spell Power 32599 30552 0
Crit 26.09% 26.09% 3881
Haste 20.22% 20.22% 6570
Damage / Heal Versatility 2.74% 2.74% 1097
Attack Power 27166 25460 0
Mastery 53.44% 51.30% 6177
Armor 2623 2623 2623
Run Speed 7 0 0

Gear

Source Slot Average Item Level: 866.00
Local Head Cave Skulker's Helm
ilevel: 870, stats: { 358 Armor, +2345 Sta, +1563 AgiInt, +1005 Haste, +401 Crit }
Local Neck Amulet of the Last Guardian
ilevel: 865, stats: { +1258 Sta, +1387 Haste, +555 Vers }, gems: { +150 Mastery }, enchant: mark_of_the_hidden_satyr
Local Shoulders Burning Sky Pauldrons
ilevel: 850, stats: { 310 Armor, +973 AgiInt, +1459 Sta, +678 Haste, +301 Mastery }, gems: { +150 Mastery }
Local Shirt Orange Martial Shirt
ilevel: 1
Local Chest Mardum Chain Vest
ilevel: 865, stats: { 434 Armor, +1491 AgiInt, +2237 Sta, +838 Crit, +542 Vers }
Local Waist Storm Tempests
ilevel: 895, stats: { 268 Armor, +2219 Sta, +1479 AgiInt, +662 Crit, +496 Haste }
Local Legs Mute Erasure Legguards
ilevel: 860, stats: { 373 Armor, +1424 AgiInt, +2136 Sta, +794 Mastery, +561 Haste }, gems: { +200 Agi }
Local Feet Gravenscale Treads of the Feverflare
ilevel: 855, stats: { 289 Armor, +1529 Sta, +1019 AgiInt, +712 Haste, +285 Mastery }
Local Wrists Vilescale Bracers
ilevel: 860, stats: { 187 Armor, +801 AgiInt, +1201 Sta, +462 Crit, +299 Haste }
Local Hands Gauntlets of Confinement
ilevel: 860, stats: { 267 Armor, +1068 AgiInt, +1601 Sta, +638 Mastery, +377 Crit }
Local Finger1 Ring of Collapsing Futures
ilevel: 865, stats: { +1258 Sta, +1331 Mastery, +610 Haste, +333 Avoidance }, enchant: { +200 Mastery }
Local Finger2 Arch-Druid's Tainted Seal
ilevel: 860, stats: { +1201 Sta, +1362 Mastery, +545 Haste }, enchant: { +200 Mastery }
Local Trinket1 Memento of Angerboda
ilevel: 865, stats: { +1418 StrAgi }
Local Trinket2 Bloodthirsty Instinct
ilevel: 850, stats: { +1233 Agi }, gems: { +150 Mastery }
Local Back Cloak of Fading Echoes
ilevel: 865, stats: { 137 Armor, +839 StrAgiInt, +1258 Sta, +277 Haste, +499 Crit }, enchant: { +200 Agi }
Local Main Hand Doomhammer
ilevel: 883, weapon: { 4481 - 8323, 2.6 }, stats: { +756 Agi, +1134 Sta, +321 Crit, +308 Mastery }, relics: { +45 ilevels, +43 ilevels, +45 ilevels }
Local Off Hand Fury of the Stonemother
ilevel: 883, weapon: { 4481 - 8323, 2.6 }, stats: { +756 Agi, +1134 Sta, +321 Crit, +308 Mastery }
Local Tabard Nightfallen Tabard
ilevel: 800

Talents

Level
15 Windsong (Enhancement Shaman) Hot Hand (Enhancement Shaman) Boulderfist (Enhancement Shaman)
30 Rainfall (Enhancement Shaman) Feral Lunge (Enhancement Shaman) Wind Rush Totem
45 Lightning Surge Totem Earthgrab Totem Voodoo Totem
60 Lightning Shield (Enhancement Shaman) Ancestral Swiftness Hailstorm (Enhancement Shaman)
75 Tempest (Enhancement Shaman) Overcharge (Enhancement Shaman) Empowered Stormlash (Enhancement Shaman)
90 Crashing Storm (Enhancement Shaman) Fury of Air (Enhancement Shaman) Sundering (Enhancement Shaman)
100 Ascendance (Enhancement Shaman) Landslide (Enhancement Shaman) Earthen Spike (Enhancement Shaman)

Profile

shaman="Bowflexn"
origin="https://us.api.battle.net/wow/character/thrall/Bowflexn/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/69/158226501-avatar.jpg"
level=110
race=tauren
role=attack
position=back
professions=leatherworking=800/enchanting=174
talents=3313112
artifact=41:0:0:0:0:899:1:900:1:901:1:902:1:903:1:904:1:905:3:906:1:907:3:908:3:909:3:910:3:911:3:912:3:1351:1
spec=enhancement

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=seventh_demon
actions.precombat+=/augmentation,type=defiled
actions.precombat+=/food,name=nightborne_delicacy_platter
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=old_war
actions.precombat+=/lightning_shield

# Executed every time the actor is available.
actions=wind_shear
# Bloodlust casting behavior mirrors the simulator settings for proxy bloodlust. See options 'bloodlust_percent', and 'bloodlust_time'.
actions+=/bloodlust,if=target.health.pct<25|time>0.500
actions+=/auto_attack
actions+=/feral_spirit
actions+=/crash_lightning,if=artifact.alpha_wolf.rank&prev_gcd.feral_spirit
actions+=/potion,name=old_war,if=feral_spirit.remains>5|target.time_to_die<=30
actions+=/berserking,if=buff.ascendance.up|!talent.ascendance.enabled|level<100
actions+=/blood_fury
actions+=/crash_lightning,if=talent.crashing_storm.enabled&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd&maelstrom>=50&active_enemies>=3
actions+=/boulderfist,if=buff.boulderfist.remains<gcd|(charges_fractional>1.75&maelstrom<=100&active_enemies<=2)
actions+=/crash_lightning,if=buff.crash_lightning.remains<gcd&active_enemies>=2
actions+=/windstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/stormstrike,if=active_enemies>=3&!talent.hailstorm.enabled
actions+=/windstrike,if=buff.stormbringer.react
actions+=/stormstrike,if=buff.stormbringer.react
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<gcd
actions+=/flametongue,if=buff.flametongue.remains<gcd
actions+=/windsong
actions+=/ascendance
actions+=/fury_of_air,if=!ticking
actions+=/doom_winds
actions+=/crash_lightning,if=active_enemies>=3
actions+=/windstrike
actions+=/stormstrike
actions+=/lightning_bolt,if=talent.overcharge.enabled&maelstrom>=60
actions+=/lava_lash,if=buff.hot_hand.react
actions+=/earthen_spike
actions+=/crash_lightning,if=active_enemies>1|talent.crashing_storm.enabled|feral_spirit.remains>5
actions+=/frostbrand,if=talent.hailstorm.enabled&buff.frostbrand.remains<4.8
actions+=/flametongue,if=buff.flametongue.remains<4.8
actions+=/sundering
actions+=/lava_lash,if=maelstrom>=90
actions+=/rockbiter
actions+=/flametongue
actions+=/boulderfist

head=cave_skulkers_helm,id=141455,bonus_id=1482/3336
neck=amulet_of_the_last_guardian,id=142207,bonus_id=1808/3453/1477/3336,gems=150mastery,enchant=mark_of_the_hidden_satyr
shoulders=burning_sky_pauldrons,id=137321,bonus_id=3410/1808/1502/3336,gems=150mastery
back=cloak_of_fading_echoes,id=134405,bonus_id=3412/1517/3337,enchant=200agi
chest=mardum_chain_vest,id=134390,bonus_id=3414/1527/3336
shirt=orange_martial_shirt,id=10052
tabard=nightfallen_tabard,id=140575
wrists=vilescale_bracers,id=121316,bonus_id=3412/1522/3336
hands=gauntlets_of_confinement,id=142133,bonus_id=3453/1472
waist=storm_tempests,id=137103,bonus_id=3459/3458
legs=mute_erasure_legguards,id=134475,bonus_id=3412/1808/1512/3336,gems=200agi
feet=gravenscale_treads,id=128901,bonus_id=689/1697/3408/600/670
finger1=ring_of_collapsing_futures,id=142173,bonus_id=40/3453/1477/3336,enchant=200mastery
finger2=archdruids_tainted_seal,id=134487,bonus_id=3412/1512/3336,enchant=200mastery
trinket1=memento_of_angerboda,id=133644,bonus_id=3414/1517/3336
trinket2=bloodthirsty_instinct,id=139329,bonus_id=1807/1808/1472,gems=150mastery
main_hand=doomhammer,id=128819,bonus_id=745,gem_id=142183/141268/137365/0,relic_id=3452:1472/3432:1512:3337/3410:1507:3336/0
off_hand=fury_of_the_stonemother,id=128873

# Gear Summary
# gear_ilvl=865.69
# gear_agility=15220
# gear_stamina=21970
# gear_crit_rating=3881
# gear_haste_rating=6570
# gear_mastery_rating=6177
# gear_versatility_rating=1097
# gear_avoidance_rating=333
# gear_armor=2623

Alacastria

Alacastria : 274651 dps, 124297 dps to main target, 13327 dtps, 50505 hps (50505 aps), 59.6k TMI, 63.5k ETMI

  • Race: Blood Elf
  • Class: Warrior
  • Spec: Protection
  • Level: 110
  • Role: Tank
  • Position: front

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR APS APS Error APS Range APR
274651.1 274651.1 373.3 / 0.136% 67992.6 / 24.8% 57798.1 50505.4 79.66 / 0.16% 7914 / 15.7% 0.0
DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
13326.7 28.89 / 0.22% 5760 / 43.2%       59.6k 18 / 0.03% 57.3k 63.9k 3.5k / 5.9%       17.4% 5.2% 33.9% 30.9       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
4.7 4.7 Rage 4.29% 57.6 100.0% 100%
Origin https://us.api.battle.net/wow/character/thrall/Alacastria/advanced
Talents
  • 15: Shockwave (Protection Warrior)
  • 30: Inspiring Presence (Protection Warrior)
  • 45: Renewed Fury (Protection Warrior)
  • 60: Crackling Thunder (Protection Warrior)
  • 75: Indomitable (Protection Warrior)
  • 90: Booming Voice (Protection Warrior)
  • 100: Heavy Repercussions (Protection Warrior)
  • Talent Calculator
Artifact
Professions
  • mining: 784
  • blacksmithing: 758
Scale Factors for Alacastria Damage Taken Per Second
Haste Vers Mastery Crit Str
Scale Factors -0.27 -0.19 -0.12 -0.11 -0.08
Normalized 3.46 2.38 1.52 1.37 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Vers > Mastery ~= Crit ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.08, CritRating=0.11, HasteRating=0.27, MasteryRating=0.12, Versatility=0.19 )

Scale Factors for other metrics

Scale Factors for Alacastria Damage Per Second
Str Vers Mastery Crit Haste
Scale Factors 10.93 5.92 4.90 4.87 3.36
Normalized 1.00 0.54 0.45 0.45 0.31
Scale Deltas 1138 1138 1138 1138 1138
Error 0.48 0.47 0.47 0.47 0.47
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Mastery ~= Crit > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.93, CritRating=4.87, HasteRating=3.36, MasteryRating=4.90, Versatility=5.92 )
Scale Factors for Alacastria Priority Target Damage Per Second
Str Vers Crit Mastery Haste
Scale Factors 4.83 2.72 2.41 2.32 1.97
Normalized 1.00 0.56 0.50 0.48 0.41
Scale Deltas 1138 1138 1138 1138 1138
Error 0.06 0.06 0.06 0.06 0.06
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Crit > Mastery > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=4.83, CritRating=2.41, HasteRating=1.97, MasteryRating=2.32, Versatility=2.72 )
Scale Factors for Alacastria Damage Per Second (Effective)
Str Vers Mastery Crit Haste
Scale Factors 10.93 5.92 4.90 4.87 3.36
Normalized 1.00 0.54 0.45 0.45 0.31
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Str > Vers > Mastery > Crit > Haste
Pawn string ( Pawn: v1: "Alacastria": Strength=10.93, CritRating=4.87, HasteRating=3.36, MasteryRating=4.90, Versatility=5.92 )
Scale Factors for Alacastria Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Pawn string ( Pawn: v1: "Alacastria": )
Scale Factors for Alacastria Absorb Per Second
Vers Mastery Crit Haste Str
Scale Factors -0.81 -0.65 -0.38 -0.28 -0.21
Normalized 3.81 3.06 1.80 1.30 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit > Haste ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.21, CritRating=0.38, HasteRating=0.28, MasteryRating=0.65, Versatility=0.81 )
Scale Factors for Healing + Absorb per second
Vers Mastery Crit Haste Str
Scale Factors -0.81 -0.65 -0.38 -0.28 -0.21
Normalized 3.81 3.06 1.80 1.30 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.10 0.10 0.10 0.10 0.10
Gear Ranking
Optimizers
Ranking
  • Vers > Mastery > Crit > Haste ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.21, CritRating=0.38, HasteRating=0.28, MasteryRating=0.65, Versatility=0.81 )
Scale Factors for Alacastria Damage Taken Per Second
Haste Vers Mastery Crit Str
Scale Factors -0.27 -0.19 -0.12 -0.11 -0.08
Normalized 3.46 2.38 1.52 1.37 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.04 0.04 0.04 0.04 0.04
Gear Ranking
Optimizers
Ranking
  • Haste > Vers > Mastery ~= Crit ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.08, CritRating=0.11, HasteRating=0.27, MasteryRating=0.12, Versatility=0.19 )
Scale Factors for Alacastria Damage Taken
Haste Vers Mastery Crit Str
Scale Factors -108.57 -74.67 -47.80 -43.21 -31.18
Normalized 3.48 2.39 1.53 1.39 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Haste > Vers > Mastery > Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=31.18, CritRating=43.21, HasteRating=108.57, MasteryRating=47.80, Versatility=74.67 )
Scale Factors for Alacastria Healing Taken Per Second
Mastery Haste Vers Crit Str
Scale Factors 0.18 0.10 0.07 0.06 0.01
Normalized 30.51 16.99 12.13 10.29 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.00 0.00 0.00 0.00 0.00
Gear Ranking
Optimizers
Ranking
  • Mastery > Haste > Vers > Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.01, CritRating=0.06, HasteRating=0.10, MasteryRating=0.18, Versatility=0.07 )
Scale Factors for Alacastria Theck-Meloree Index
Haste Mastery Crit Vers Str
Scale Factors -0.14 -0.05 -0.04 -0.03 -0.03
Normalized 5.17 1.66 1.59 1.18 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Mastery ~= Crit ~= Vers ~= Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.03, CritRating=0.04, HasteRating=0.14, MasteryRating=0.05, Versatility=0.03 )
Scale Factors for AlacastriaTheck-Meloree Index (Effective)
Haste Vers Mastery Crit Str
Scale Factors -0.14 -0.09 -0.08 -0.05 -0.03
Normalized 4.76 3.22 2.78 1.81 1.00
Scale Deltas 1138 1138 1138 1138 1138
Error 0.02 0.02 0.02 0.02 0.02
Gear Ranking
Optimizers
Ranking
  • Haste > Vers ~= Mastery > Crit > Str
Pawn string ( Pawn: v1: "Alacastria": Strength=0.03, CritRating=0.05, HasteRating=0.14, MasteryRating=0.08, Versatility=0.09 )

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% B% Up%
Alacastria 274651
auto_attack_mh 12880 4.7% 164.4 2.45sec 31366 14581 Direct 164.4 25483 54446 31366 20.3% 7.5%  

Stats details: auto_attack_mh

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 164.41 164.41 0.00 0.00 2.1511 0.0000 5156795.96 7756384.56 33.52 14581.22 14581.22
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 121.13 73.68% 26073.27 25054 33071 26072.05 25737 26421 3158181 4642826 31.98
hit (blocked) 9.89 6.01% 18257.90 17538 23150 18259.18 17538 20577 180530 379138 52.38
crit 30.88 18.78% 55709.64 50107 66142 55768.32 53350 59285 1720210 2528872 31.98
crit (blocked) 2.51 1.53% 38929.69 35075 46299 35705.74 0 46299 97874 205549 48.01
 
 

Action details: auto_attack_mh

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.60
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
Deep Wounds 52115 18.9% 317.3 2.19sec 65156 0 Periodic 370.0 43498 93015 55875 25.0% 0.0% 277.2%

Stats details: deep_wounds

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 317.31 0.00 370.01 370.01 0.0000 3.0000 20674443.61 20674443.61 0.00 18625.05 0.00
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 277.5 75.00% 43497.66 41808 55187 43497.89 42841 44274 12071577 12071577 0.00
crit 92.5 25.00% 93015.39 83616 110373 93041.51 88538 96995 8602866 8602866 0.00
 
 

Action details: deep_wounds

Static Values
  • id:115767
  • school:physical
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:115767
  • name:Deep Wounds
  • school:physical
  • tooltip:Bleeding for $w1 every $t1 sec.
  • description:{$@spelldesc115768=Your Devastate and Revenge also cause $115767o1 Bleed damage over {$115767d=15 seconds}.}
Damage Over Time
  • tick_may_crit:true
  • tick_zero:false
  • attack_power_mod.tick:1.050000
  • spell_power_mod.tick:0.000000
  • base_td:1.00
  • dot_duration:15.00
  • base_tick_time:3.00
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 
Devastate 32620 12.0% 140.2 2.86sec 93598 66383 Direct 140.2 77478 164643 93598 18.5% 7.5%  

Stats details: devastate

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 140.17 140.17 0.00 0.00 1.4100 0.0000 13119486.94 19732646.12 33.51 66383.41 66383.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 105.63 75.36% 79270.63 75152 99200 79268.83 77861 80762 8373602 12309989 31.98
hit (blocked) 8.61 6.14% 55488.25 52606 69440 55475.57 0 63829 477874 1003600 52.36
crit 23.97 17.10% 168449.19 150303 198400 168646.81 157150 183370 4038378 5936799 31.98
crit (blocked) 1.95 1.39% 117826.98 105212 138880 100349.19 0 138880 229632 482258 44.58
 
 

Action details: devastate

Static Values
  • id:20243
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:20243
  • name:Devastate
  • school:physical
  • tooltip:
  • description:A direct strike, dealing ${$sw1*$<mult>} Physical damage.$?a231834[ {$s3=30}% chance to reset the remaining cooldown on Shield Slam.][]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
Weapon
  • normalized:true
  • weapon_power_mod:0.285714
  • weapon_multiplier:3.20
 
Gaseous Explosion (gaseous_bubble) 27923 10.1% 7.0 60.04sec 1575171 0 Direct 31.9 201322 410884 346502 69.3% 0.0%  

Stats details: gaseous_bubble

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.02 31.90 0.00 0.00 0.0000 0.0000 11054555.78 11054555.78 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.80 30.72% 201321.50 179363 236759 201301.50 0 236759 1973154 1973154 0.00
crit 22.10 69.28% 410883.64 358725 473517 410246.71 358725 473517 9081402 9081402 0.00
 
 

Action details: gaseous_bubble

Static Values
  • id:214972
  • school:frost
  • resource:none
  • range:10.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:214972
  • name:Gaseous Explosion
  • school:frost
  • tooltip:
  • description:{$@spelldesc214971=Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:137680.00
  • base_dd_max:137680.00
 
Neltharion's Fury 37601 13.6% 5.0 60.63sec 2965772 1971457 Periodic 180.0 39074 82456 82450 100.0% 0.0% 3.7%

Stats details: neltharions_fury

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 5.00 0.00 30.03 180.03 1.5045 0.5000 14843098.77 14843098.77 0.00 658434.94 1971456.87
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 0.0 0.01% 39073.86 35836 39419 187.59 0 39419 973 973 0.00
crit 180.0 99.99% 82455.62 71671 94606 82455.44 77978 85146 14842126 14842126 0.00
 
 

Action details: neltharions_fury

Static Values
  • id:203524
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:45.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
Spelldata
  • id:203524
  • name:Neltharion's Fury
  • school:physical
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:0.00
  • dot_duration:3.00
  • base_tick_time:0.50
  • hasted_ticks:false
  • dot_behavior:DOT_REFRESH
 

Action details: neltharions_fury_shadowflame

Static Values
  • id:203526
  • school:shadowflame
  • resource:none
  • range:100.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:203526
  • name:Neltharion's Fury
  • school:shadowflame
  • tooltip:
  • description:{$@spelldesc203524=Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.}
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.900000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Revenge 54107 19.6% 42.5 9.24sec 503672 355988 Direct 177.1 95784 202868 120876 23.4% 5.2%  

Stats details: revenge

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 42.51 177.14 0.00 0.00 1.4149 0.0000 21411944.24 31646782.05 32.34 355987.63 355987.63
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 128.49 72.54% 96325.37 92141 121625 96315.68 93498 99877 12376877 18195182 31.98
hit (blocked) 7.14 4.03% 86049.02 64498 121625 85935.44 0 121625 614681 1011447 39.19
crit 39.35 22.22% 203870.61 184281 243251 203674.68 185956 223847 8022994 11794561 31.98
crit (blocked) 2.15 1.22% 184550.64 128997 243251 162281.00 0 243251 397392 645592 33.90
 
 

Action details: revenge

Static Values
  • id:6572
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:cooldown.shield_slam.remains<=gcd.max*2
Spelldata
  • id:6572
  • name:Revenge
  • school:physical
  • tooltip:
  • description:Swing in a wide arc, dealing {$s1=1} damage to all enemies in front of you. Your successful dodges and parries reset the remaining cooldown on Revenge up to once per $5302m1 sec. |cFFFFFFFFGenerates {$/10;s2=5} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:3.402000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Shield Slam 32655 12.0% 56.4 7.20sec 232249 164584 Direct 56.4 169674 362258 232247 32.5% 7.5%  

Stats details: shield_slam

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 56.40 56.40 0.00 0.00 1.4111 0.0000 13098084.66 19698303.96 33.51 164583.95 164583.95
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 35.19 62.40% 173623.85 133471 229036 173540.24 161962 182865 6109773 8981945 31.98
hit (blocked) 2.88 5.11% 121457.65 93429 160325 114089.91 0 160325 350115 735290 49.24
crit 16.96 30.08% 370501.83 266941 458071 370838.49 330340 420394 6285375 9240097 31.98
crit (blocked) 1.36 2.41% 259417.98 186859 320650 192854.41 0 320650 352822 740973 38.92
 
 

Action details: shield_slam

Static Values
  • id:23922
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:9.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
Spelldata
  • id:23922
  • name:Shield Slam
  • school:physical
  • tooltip:
  • description:Slams the target with your shield, causing {$s1=1} Physical damage. |cFFFFFFFFGenerates {$/10;s3=20} Rage.|r
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:4.928000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Thunder Clap 24748 9.0% 27.1 10.88sec 359858 256188 Direct 162.9 46924 99414 59976 24.9% 0.0%  

Stats details: thunder_clap

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 27.15 162.87 0.00 0.00 1.4047 0.0000 9768464.07 14360567.47 31.98 256188.41 256188.41
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 122.37 75.13% 46923.66 44798 59133 46920.75 45490 48928 5742067 8441383 31.98
crit 40.50 24.87% 99414.11 89596 118266 99362.81 90449 107652 4026397 5919185 31.98
 
 

Action details: thunder_clap

Static Values
  • id:6343
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:6.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:spell_targets.thunder_clap>=3
Spelldata
  • id:6343
  • name:Thunder Clap
  • school:physical
  • tooltip:Movement speed reduced by {$s2=50}%.
  • description:Blasts all enemies within $6343A1 yards for $?s12712[${$6343m1*1.2}][$6343m1] damage{$?s199045=false}[, rooting them for {$199042d=1 second} and reducing their movement speed by {$s2=50}% for {$d=10 seconds}.][ and reduces their movement speed by {$s2=50}% for {$d=10 seconds}.]
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:1.654000
  • spell_power_mod.direct:0.000000
  • base_dd_min:1.00
  • base_dd_max:1.00
 
Healing and Absorb Stats HPS HPS% Execute Interval HPE HPET Type Count Hit Crit Avg Crit% Up%
Alacastria 0
Ignore Pain 50478 99.9% 26.7 15.48sec 758622 0 Direct 237.1 85308 0 85308 0.0%  

Stats details: ignore_pain

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
absorb 26.67 237.14 0.00 0.00 0.0000 0.0000 20229375.66 0.00 0.00 0.00 0.00
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 237.14 100.00% 85307.56 0 208370 85297.62 76330 95117 20229376 0 0.00
 
 

Action details: ignore_pain

Static Values
  • id:190456
  • school:physical
  • resource:rage
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:20.0
  • secondary_cost:40.0
  • cooldown:1.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
Spelldata
  • id:190456
  • name:Ignore Pain
  • school:physical
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
 
Simple Action Stats Execute Interval
Alacastria
Arcane Torrent 4.9 90.29sec

Stats details: arcane_torrent

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 4.93 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: arcane_torrent

Static Values
  • id:69179
  • school:arcane
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:69179
  • name:Arcane Torrent
  • school:arcane
  • tooltip:Silenced.
  • description:Silence all enemies within $A1 yards for {$d=2 seconds} and increase your Rage by {$/10;s2=15}. Non-player victim spellcasting is also interrupted for {$32747d=3 seconds}.
 
augmentation 1.0 0.00sec

Stats details: augmentation

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: augmentation

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Battle Cry 7.1 60.71sec

Stats details: battle_cry

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 7.06 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: battle_cry

Static Values
  • id:1719
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
Spelldata
  • id:1719
  • name:Battle Cry
  • school:physical
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
 
Demoralizing Shout 3.7 121.38sec

Stats details: demoralizing_shout

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 3.72 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: demoralizing_shout

Static Values
  • id:1160
  • school:physical
  • resource:none
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:90.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:incoming_damage_2500ms>health.max*0.20
Spelldata
  • id:1160
  • name:Demoralizing Shout
  • school:physical
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
 
flask 1.0 0.00sec

Stats details: flask

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: flask

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
food 1.0 0.00sec

Stats details: food

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 1.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: food

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:false
  • if_expr:
 
Intercept 20.1 20.42sec

Stats details: intercept

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 20.11 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: intercept

Static Values
  • id:198304
  • school:physical
  • resource:none
  • range:25.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:20.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:198304
  • name:Intercept
  • school:physical
  • tooltip:
  • description:Run at high speed toward an ally or enemy. When targeting an enemy, Intercept will root for {$105771d=1.500 seconds}, but has a minimum range of {$s1=8} yds. When targeting an ally, Intercept will intercept the next melee or ranged attack against the ally within {$147833d=10 seconds} while the target remains within $147833A2 yards. |cFFFFFFFFGenerates {$/10;s2=10} Rage.|r
 
potion 2.0 0.00sec

Stats details: potion

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 2.00 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: potion

Static Values
  • id:0
  • school:none
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:60.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:false
  • if_expr:
 
Shield Block 28.8 14.26sec

Stats details: shield_block

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 28.81 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:10.0
  • secondary_cost:0.0
  • cooldown:13.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 
Shield Block (_heavy_repercussions) 49.1 8.28sec

Stats details: shield_block_heavy_repercussions

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 49.13 0.00 0.00 0.00 0.0000 0.0000 0.00 0.00 0.00 0.00 0.00
 
 

Action details: shield_block_heavy_repercussions

Static Values
  • id:2565
  • school:physical
  • resource:rage
  • range:0.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:0.00
  • base_crit:0.00
  • target:Fluffy_Pillow
  • harmful:true
  • if_expr:
Spelldata
  • id:2565
  • name:Shield Block
  • school:physical
  • tooltip:
  • description:Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.
 

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Battle Cry 7.1 0.0 60.9sec 60.7sec 8.79% 8.79% 0.0(0.0) 7.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_battle_cry
  • max_stacks:1
  • duration:5.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • battle_cry_1:8.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1719
  • name:Battle Cry
  • tooltip:Critical strike chance increased by $w1%.
  • description:Lets loose a battle cry, granting {$s1=100}% increased critical strike chance for {$d=5 seconds}.$?a202751[ |cFFFFFFFFGenerates ${{$202751s2=1000}/10} Rage.|r][]
  • max_stacks:0
  • duration:5.00
  • cooldown:60.00
  • default_chance:0.00%
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 26.56% 0.0(0.0) 1.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
Demoralizing Shout 3.7 0.0 121.8sec 121.4sec 7.40% 7.40% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • demoralizing_shout_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing {$s1=20}% less damage.][Demoralized, dealing {$s1=20}% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by {$s1=20}% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by {$s1=20}% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Dragon Scales 13.8 0.0 28.9sec 28.9sec 24.19% 24.19% 0.0(0.0) 3.2

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_dragon_scales
  • max_stacks:1
  • duration:12.00
  • cooldown:15.00
  • default_chance:20.00%
  • default_value:0.40

Stack Uptimes

  • dragon_scales_1:24.19%

Trigger Attempt Success

  • trigger_pct:20.58%

Spelldata details

  • id:203581
  • name:Dragon Scales
  • tooltip:Your next Ignore Pain will ignore {$s1=40}% more damage.
  • description:{$@spelldesc203576=Blocking an attack has a chance to increase the total damage ignored by your next Ignore Pain by {$203581s1=40}%.}
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Gaseous Bubble 7.1 0.0 60.4sec 60.5sec 9.04% 100.00% 0.0(0.0) 1.1

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_gaseous_bubble
  • max_stacks:1
  • duration:8.00
  • cooldown:60.00
  • default_chance:100.00%
  • default_value:308250.00

Stack Uptimes

  • gaseous_bubble_1:9.04%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214971
  • name:Gaseous Bubble
  • tooltip:Absorbs $w1 damage. Causes a Gaseous Explosion when removed.
  • description:Become enveloped by a Gaseous Bubble that absorbs up to {$s1=212375} damage for {$d=8 seconds}. When the bubble is consumed or expires, it explodes and deals {$s2=94857} Frost damage to all nearby enemies within $214972A1 yards.
  • max_stacks:0
  • duration:8.00
  • cooldown:60.00
  • default_chance:0.00%
Ignore Pain 15.6 11.1 26.3sec 15.5sec 86.45% 100.00% 11.1(11.1) 14.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_ignore_pain
  • max_stacks:1
  • duration:15.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:186.00

Stack Uptimes

  • ignore_pain_1:86.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:190456
  • name:Ignore Pain
  • tooltip:Ignoring {$s2=90}% of the next ${$w1*10/9} total damage that you take, from any sources.
  • description:Fight through the pain, ignoring {$s2=90}% of the next up to ${($m1/10)*$AP*(1+$@versadmg)} damage you take from any sources, based on Rage spent.
  • max_stacks:0
  • duration:15.00
  • cooldown:1.00
  • default_chance:0.00%
intercept_movement 2.9 0.0 88.9sec 88.9sec 0.24% 1.60% 0.0(0.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_intercept_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • intercept_movement_1:0.24%

Trigger Attempt Success

  • trigger_pct:100.00%
Mark of the Heavy Hide 9.0 2.4 42.8sec 33.1sec 25.20% 25.20% 2.4(2.4) 8.8

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_mark_of_the_heavy_hide
  • max_stacks:1
  • duration:10.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3000.00

Stack Uptimes

  • mark_of_the_heavy_hide_1:25.20%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:228399
  • name:Mark of the Heavy Hide
  • tooltip:Armor increased by {$s1=3000}.
  • description:Armor increased by {$s1=3000}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:0.00%
Neltharion's Fury 5.0 0.0 60.6sec 60.6sec 3.80% 3.80% 30.0(30.0) 5.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_neltharions_fury
  • max_stacks:1
  • duration:3.00
  • cooldown:45.00
  • default_chance:100.00%
  • default_value:3.00

Stack Uptimes

  • neltharions_fury_1:3.80%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:203524
  • name:Neltharion's Fury
  • tooltip:Critically blocking all incoming attacks, and dealing {$203526s1=1} Shadowflame damage to all enemies in a $203526A1 yard cone every $t2 sec.
  • description:Enter a defensive posture, critically blocking all attacks while a stream of shadowflame erupts from |cFFFFCC99Scale of the Earth-Warder|r, dealing ${6*{$203526s1=1}} Shadowflame over {$d=3 seconds} to all enemies in front of you. You can use defensive abilities while this is active.
  • max_stacks:0
  • duration:3.00
  • cooldown:45.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 13.33% 13.33% 2.0(2.0) 0.0

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:13.33%

Trigger Attempt Success

  • trigger_pct:100.00%
Renewed Fury 25.0 1.7 16.3sec 15.5sec 38.79% 38.79% 1.7(1.7) 24.6

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_renewed_fury
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • renewed_fury_1:38.79%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202289
  • name:Renewed Fury
  • tooltip:Damage done increased by {$s1=10}%.
  • description:{$@spelldesc202288=Ignore Pain also enrages you, increasing all damage you deal by {$202289s1=10}% for {$202289d=6 seconds}.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Shield Block 28.1 0.0 14.5sec 14.5sec 60.99% 87.01% 0.0(0.0) 27.4

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_shield_block
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • shield_block_1:60.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:132404
  • name:Shield Block
  • tooltip:Block chance increased by {$s1=100}%.
  • description:{$@spelldesc2565=Raise your shield, blocking every melee attack against you for {$132404d=6 seconds}. These blocks can be critical blocks. Increases Shield Slam damage by {$132404s2=30}% while active.}
  • max_stacks:0
  • duration:6.00
  • cooldown:0.00
  • default_chance:0.00%
Unbending Potion 2.0 0.0 320.0sec 0.0sec 11.86% 11.86% 0.0(0.0) 1.5

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_unbending_potion
  • max_stacks:1
  • duration:25.00
  • cooldown:1.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:bonus_armor
  • amount:3500.00

Stack Uptimes

  • unbending_potion_1:11.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188029
  • name:Unbending Potion
  • tooltip:Armor increased by {$s1=3500}.
  • description:Increases your Armor by {$s1=3500} for {$d=25 seconds}.
  • max_stacks:0
  • duration:25.00
  • cooldown:1.00
  • default_chance:0.00%
Constant Buffs
Defiled Augmentation

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_defiled_augmentation
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:agility
  • amount:325.00
  • stat:strength
  • amount:325.00
  • stat:intellect
  • amount:325.00

Stack Uptimes

  • defiled_augmentation_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:224001
  • name:Defiled Augmentation
  • tooltip:Agility, Intellect and Strength increased by $w1.
  • description:Increases Agility, Intellect and Strength by {$s1=325} for {$d=3600 seconds}. Augment Rune.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%
Flask of the Countless Armies

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_flask_of_the_countless_armies
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:strength
  • amount:1300.00

Stack Uptimes

  • flask_of_the_countless_armies_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:188034
  • name:Flask of the Countless Armies
  • tooltip:Strength increased by $w1.
  • description:Increases Strength by {$s1=1300} for {$d=3600 seconds}. Counts as both a Battle and Guardian elixir. This effect persists through death.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:101.00%
Well Fed (seedbattered_fish_plate)

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_seedbattered_fish_plate
  • max_stacks:1
  • duration:3600.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stat Buff details

  • stat:versatility_rating
  • amount:375.00

Stack Uptimes

  • seedbattered_fish_plate_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:225605
  • name:Well Fed
  • tooltip:Versatility increased by $w1.
  • description:Increases versatility by {$s1=375} for {$d=3600 seconds}.
  • max_stacks:0
  • duration:3600.00
  • cooldown:0.00
  • default_chance:0.00%

Cooldown waste details

Seconds per Execute Seconds per Iteration
Ability Average Minimum Maximum Average Minimum Maximum
Intercept0.4880.0011.2558.0624.90411.477
Shield Block2.0290.00322.33254.61318.950113.078
Ignore Pain14.2850.45133.047366.632270.542457.697
Demoralizing Shout31.8400.00133.68286.74434.847128.577
Battle Cry1.0230.0012.6145.5201.89210.104
Neltharion's Fury15.63615.00097.90862.62161.318159.408
Shield Slam1.6990.00123.49793.33743.638157.365
Revenge2.1200.00146.55987.65832.964176.305
Thunder Clap5.2660.00725.025137.671105.881172.434

Resources

Resource Usage Type Count Total Average RPE APR
Alacastria
ignore_pain Rage 26.7 1600.0 60.0 60.0 12643.7
shield_block Rage 28.8 288.1 10.0 10.0 0.0
Resource Gains Type Count Total Average Overflow
ignore_pain Health 237.14 20229464.77 (100.00%) 85307.56 0.00 0.00%
intercept Rage 20.11 201.10 (10.47%) 10.00 0.00 0.00%
arcane_torrent Rage 4.93 73.91 (3.85%) 15.00 0.00 0.00%
shield_slam Rage 56.40 1127.93 (58.73%) 20.00 0.00 0.00%
revenge Rage 42.51 212.56 (11.07%) 5.00 0.00 0.00%
booming_voice Rage 3.72 186.23 (9.70%) 50.00 0.00 0.00%
rage_from_damage_taken Rage 274.71 118.94 (6.19%) 0.43 0.00 0.00%
Resource RPS-Gain RPS-Loss
Health 8302.37 13321.51
Rage 4.80 4.71
Combat End Resource Mean Min Max
Rage 32.49 0.01 82.72

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval
parry_haste 19.6 19.5sec
delayed_auto_attack 13.0 27.8sec

Statistics & Data Analysis

Fight Length
Sample Data Alacastria Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Alacastria Damage Per Second
Count 9999
Mean 274651.11
Minimum 233253.24
Maximum 331478.26
Spread ( max - min ) 98225.02
Range [ ( max - min ) / 2 * 100% ] 17.88%
Standard Deviation 19042.9123
5th Percentile 247319.92
95th Percentile 308092.02
( 95th Percentile - 5th Percentile ) 60772.11
Mean Distribution
Standard Deviation 190.4386
95.00% Confidence Intervall ( 274277.86 - 275024.36 )
Normalized 95.00% Confidence Intervall ( 99.86% - 100.14% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 184
0.1% Error 18467
0.1 Scale Factor Error with Delta=300 3095639
0.05 Scale Factor Error with Delta=300 12382558
0.01 Scale Factor Error with Delta=300 309563967
Priority Target DPS
Sample Data Alacastria Priority Target Damage Per Second
Count 9999
Mean 124296.90
Minimum 115395.46
Maximum 134389.10
Spread ( max - min ) 18993.64
Range [ ( max - min ) / 2 * 100% ] 7.64%
Standard Deviation 2467.5846
5th Percentile 120347.09
95th Percentile 128402.92
( 95th Percentile - 5th Percentile ) 8055.83
Mean Distribution
Standard Deviation 24.6771
95.00% Confidence Intervall ( 124248.54 - 124345.27 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 15
0.1% Error 1513
0.1 Scale Factor Error with Delta=300 51978
0.05 Scale Factor Error with Delta=300 207915
0.01 Scale Factor Error with Delta=300 5197898
DPS(e)
Sample Data Alacastria Damage Per Second (Effective)
Count 9999
Mean 274651.11
Minimum 233253.24
Maximum 331478.26
Spread ( max - min ) 98225.02
Range [ ( max - min ) / 2 * 100% ] 17.88%
Damage
Sample Data Alacastria Damage
Count 9999
Mean 109126874.04
Minimum 93764960.00
Maximum 125559284.86
Spread ( max - min ) 31794324.86
Range [ ( max - min ) / 2 * 100% ] 14.57%
DTPS
Sample Data Alacastria Damage Taken Per Second
Count 9999
Mean 13326.69
Minimum 8652.05
Maximum 19268.37
Spread ( max - min ) 10616.32
Range [ ( max - min ) / 2 * 100% ] 39.83%
Standard Deviation 1474.1345
5th Percentile 10975.76
95th Percentile 15825.60
( 95th Percentile - 5th Percentile ) 4849.84
Mean Distribution
Standard Deviation 14.7421
95.00% Confidence Intervall ( 13297.80 - 13355.58 )
Normalized 95.00% Confidence Intervall ( 99.78% - 100.22% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 470
0.1% Error 47003
0.1 Scale Factor Error with Delta=300 18550
0.05 Scale Factor Error with Delta=300 74202
0.01 Scale Factor Error with Delta=300 1855059
HPS
Sample Data Alacastria Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Alacastria Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Alacastria Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Alacastria Healing Taken Per Second
Count 9999
Mean 8278.82
Minimum 4803.98
Maximum 11790.62
Spread ( max - min ) 6986.64
Range [ ( max - min ) / 2 * 100% ] 42.20%
TMI
Sample Data Alacastria Theck-Meloree Index
Count 9999
Mean 59645.57
Minimum 57293.16
Maximum 63910.57
Spread ( max - min ) 6617.41
Range [ ( max - min ) / 2 * 100% ] 5.55%
Standard Deviation 902.4564
5th Percentile 58308.80
95th Percentile 61267.55
( 95th Percentile - 5th Percentile ) 2958.75
Mean Distribution
Standard Deviation 9.0250
95.00% Confidence Intervall ( 59627.88 - 59663.26 )
Normalized 95.00% Confidence Intervall ( 99.97% - 100.03% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 8
0.1% Error 879
0.1 Scale Factor Error with Delta=300 6952
0.05 Scale Factor Error with Delta=300 27809
0.01 Scale Factor Error with Delta=300 695242
ETMI
Sample Data AlacastriaTheck-Meloree Index (Effective)
Count 9999
Mean 63503.03
Minimum 61551.72
Maximum 66904.05
Spread ( max - min ) 5352.32
Range [ ( max - min ) / 2 * 100% ] 4.21%
Standard Deviation 697.4559
5th Percentile 62430.81
95th Percentile 64709.62
( 95th Percentile - 5th Percentile ) 2278.81
Mean Distribution
Standard Deviation 6.9749
95.00% Confidence Intervall ( 63489.36 - 63516.70 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4
0.1% Error 463
0.1 Scale Factor Error with Delta=300 4152
0.05 Scale Factor Error with Delta=300 16610
0.01 Scale Factor Error with Delta=300 415257
MSD
Sample Data Alacastria Max Spike Value
Count 2499
Mean 17.39
Minimum 5.23
Maximum 33.92
Spread ( max - min ) 28.69
Range [ ( max - min ) / 2 * 100% ] 82.49%
Standard Deviation 3.9756
5th Percentile 11.62
95th Percentile 24.76
( 95th Percentile - 5th Percentile ) 13.14
Mean Distribution
Standard Deviation 0.0795
95.00% Confidence Intervall ( 17.24 - 17.55 )
Normalized 95.00% Confidence Intervall ( 99.10% - 100.90% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 2007
0.1% Error 200754
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 13

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 flask,type=countless_armies
1 0.00 food,type=seedbattered_fish_plate
2 0.00 augmentation,type=defiled
3 0.00 snapshot_stats
Snapshot raid buffed stats before combat begins and pre-potting is done.
4 0.00 potion,name=unbending_potion
Default action list Executed every time the actor is available.
# count action,conditions
5 20.11 intercept
6 14.01 auto_attack
7 7.11 use_item,name=giant_ornamental_pearl
0.00 blood_fury
0.00 berserking
8 4.93 arcane_torrent
9 0.00 call_action_list,name=prot
actions.prot
# count action,conditions
A 28.81 shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
B 26.67 ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
0.00 focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
C 0.00 demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
0.00 shield_wall,if=incoming_damage_2500ms>health.max*0.50
0.00 last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
D 1.00 potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
E 0.00 call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
F 2.06 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
G 1.72 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
H 0.00 neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
I 32.80 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
J 15.59 revenge,if=cooldown.shield_slam.remains<=gcd.max*2
K 93.58 devastate
actions.prot_aoe
# count action,conditions
0.00 focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
L 5.00 battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
M 2.00 demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
0.00 ravager,if=talent.ravager.enabled&buff.battle_cry.up
N 5.00 neltharions_fury,if=buff.battle_cry.up
O 23.60 shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
P 26.93 revenge
Q 27.15 thunder_clap,if=spell_targets.thunder_clap>=3
R 46.59 devastate

Sample Sequence

01245678AFGBIKKKJKIKKAIBK6KIKKKJK56AOQROBPQRORAQPRROQRPR5AKIBKKKJK6RAOPQR7P5LNOBQRAOPKKKI6KKK5B6APOQRRR8P6RQAOROBPK5IKKKJB6PQRRR7QP5ALMBNOPQRKKKJAIKKOBP5QRRRAOPQRR6ROBPKK5AKKIKK6PQRAORQ78BPR5LNOQRAIKIBKIKI6P5BAQROPQRORPAQRIBKK5IKJJ6RAOBQRPR7QOLMBN5PQARIK6IBKKKJ6RAO5QR6PR8OBQRRAPQIKK6K5IBKJ6PAOQRR6O7PQLN5PBRQKKKJKAIKKKIK5KBKJKKKKKJAIKKKK5J6IBKKAKIKKKJ87KKKAFGBI5KKIBDKIKIKAK6KJKIBK5IKJAIK

Sample Sequence Table

time name target resources buffs
Pre flask Alacastria 0.0/130: 0% rage
Pre food Alacastria 0.0/130: 0% rage
Pre augmentation Alacastria 0.0/130: 0% rage
Pre potion Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 intercept Fluffy_Pillow 0.0/130: 0% rage unbending_potion
0:00.000 auto_attack Fluffy_Pillow 10.0/130: 8% rage mark_of_the_heavy_hide, unbending_potion
0:00.000 use_item_giant_ornamental_pearl Fluffy_Pillow 10.0/130: 8% rage mark_of_the_heavy_hide, unbending_potion
0:00.000 arcane_torrent Fluffy_Pillow 10.0/130: 8% rage gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 shield_block Fluffy_Pillow 25.0/130: 19% rage gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 battle_cry Fluffy_Pillow 15.0/130: 12% rage shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 demoralizing_shout Fluffy_Pillow 15.0/130: 12% rage battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 ignore_pain Alacastria 65.0/130: 50% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:00.000 shield_slam Fluffy_Pillow 5.0/130: 4% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:01.349 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:02.467 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:03.586 devastate Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:04.704 revenge Fluffy_Pillow 25.0/130: 19% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:05.824 devastate Fluffy_Pillow 30.0/130: 23% rage bloodlust, renewed_fury, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:06.943 shield_slam Fluffy_Pillow 30.0/130: 23% rage bloodlust, demoralizing_shout, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide, unbending_potion
0:08.062 devastate Fluffy_Pillow 50.0/130: 38% rage bloodlust, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
0:09.183 devastate Fluffy_Pillow 50.1/130: 39% rage bloodlust, ignore_pain, mark_of_the_heavy_hide, unbending_potion
0:10.303 shield_block Fluffy_Pillow 50.3/130: 39% rage bloodlust, ignore_pain, unbending_potion
0:10.303 shield_slam Fluffy_Pillow 40.3/130: 31% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:11.423 ignore_pain Alacastria 60.4/130: 46% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:11.423 devastate Fluffy_Pillow 0.4/130: 0% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:12.544 auto_attack Fluffy_Pillow 0.6/130: 0% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:12.544 devastate Fluffy_Pillow 0.6/130: 0% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block, unbending_potion
0:13.663 shield_slam Fluffy_Pillow 0.8/130: 1% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:14.781 devastate Fluffy_Pillow 20.9/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:15.903 devastate Fluffy_Pillow 21.0/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:17.022 devastate Fluffy_Pillow 21.3/130: 16% rage bloodlust, renewed_fury, ignore_pain, shield_block, unbending_potion
0:18.141 revenge Fluffy_Pillow 21.4/130: 16% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:19.258 devastate Fluffy_Pillow 26.6/130: 20% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:20.377 intercept Fluffy_Pillow 26.9/130: 21% rage bloodlust, raid_movement, ignore_pain, unbending_potion
0:20.377 Waiting 0.500 sec 36.9/130: 28% rage bloodlust, raid_movement, intercept_movement, ignore_pain, unbending_potion
0:20.877 auto_attack Fluffy_Pillow 36.9/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.877 shield_block Fluffy_Pillow 36.9/130: 28% rage bloodlust, intercept_movement, ignore_pain, unbending_potion
0:20.877 shield_slam Fluffy_Pillow 26.9/130: 21% rage bloodlust, intercept_movement, ignore_pain, shield_block, unbending_potion
0:21.999 thunder_clap Fluffy_Pillow 47.0/130: 36% rage bloodlust, ignore_pain, shield_block, unbending_potion
0:23.118 devastate Fluffy_Pillow 47.3/130: 36% rage bloodlust, ignore_pain, shield_block
0:24.239 shield_slam Fluffy_Pillow 47.5/130: 37% rage bloodlust, ignore_pain, shield_block
0:25.359 ignore_pain Alacastria 67.5/130: 52% rage bloodlust, ignore_pain, shield_block
0:25.359 revenge Fluffy_Pillow 7.5/130: 6% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:26.478 thunder_clap Fluffy_Pillow 12.6/130: 10% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:27.597 devastate Fluffy_Pillow 12.6/130: 10% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:28.715 shield_slam Fluffy_Pillow 12.8/130: 10% rage bloodlust, raid_movement, renewed_fury, ignore_pain, shield_block
0:29.833 devastate Fluffy_Pillow 32.8/130: 25% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:30.952 shield_block Fluffy_Pillow 33.1/130: 25% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:30.952 thunder_clap Fluffy_Pillow 23.1/130: 18% rage bloodlust, renewed_fury, ignore_pain, shield_block
0:32.071 revenge Fluffy_Pillow 23.2/130: 18% rage bloodlust, ignore_pain, shield_block
0:33.190 devastate Fluffy_Pillow 28.2/130: 22% rage bloodlust, ignore_pain, shield_block
0:34.311 devastate Fluffy_Pillow 28.3/130: 22% rage bloodlust, ignore_pain, shield_block
0:35.431 shield_slam Fluffy_Pillow 28.3/130: 22% rage bloodlust, ignore_pain, shield_block
0:36.549 thunder_clap Fluffy_Pillow 48.9/130: 38% rage bloodlust, ignore_pain, shield_block
0:37.668 devastate Fluffy_Pillow 48.9/130: 38% rage bloodlust, ignore_pain, shield_block
0:38.788 revenge Fluffy_Pillow 49.1/130: 38% rage bloodlust, ignore_pain, shield_block
0:39.907 devastate Fluffy_Pillow 54.1/130: 42% rage bloodlust, ignore_pain
0:41.036 intercept Fluffy_Pillow 54.5/130: 42% rage
0:41.036 shield_block Fluffy_Pillow 64.5/130: 50% rage
0:41.036 devastate Fluffy_Pillow 54.5/130: 42% rage shield_block
0:42.491 shield_slam Fluffy_Pillow 58.8/130: 45% rage shield_block
0:43.945 ignore_pain Alacastria 78.8/130: 61% rage shield_block
0:43.945 devastate Fluffy_Pillow 18.8/130: 14% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:45.398 devastate Fluffy_Pillow 19.0/130: 15% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:46.854 devastate Fluffy_Pillow 19.3/130: 15% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:48.309 revenge Fluffy_Pillow 19.5/130: 15% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
0:49.764 devastate Fluffy_Pillow 24.5/130: 19% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
0:51.219 Waiting 1.800 sec 24.7/130: 19% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
0:53.019 auto_attack Fluffy_Pillow 25.0/130: 19% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
0:53.019 devastate Fluffy_Pillow 25.0/130: 19% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
0:54.474 shield_block Fluffy_Pillow 25.1/130: 19% rage ignore_pain
0:54.474 shield_slam Fluffy_Pillow 15.1/130: 12% rage ignore_pain, shield_block
0:55.928 revenge Fluffy_Pillow 35.1/130: 27% rage ignore_pain, shield_block
0:57.383 thunder_clap Fluffy_Pillow 40.4/130: 31% rage ignore_pain, shield_block
0:58.838 devastate Fluffy_Pillow 40.7/130: 31% rage dragon_scales, ignore_pain, shield_block
1:00.294 use_item_giant_ornamental_pearl Fluffy_Pillow 42.0/130: 32% rage raid_movement, dragon_scales, shield_block
1:00.294 Waiting 0.300 sec 42.0/130: 32% rage raid_movement, dragon_scales, shield_block, gaseous_bubble
1:00.594 revenge Fluffy_Pillow 42.0/130: 32% rage raid_movement, dragon_scales, shield_block, gaseous_bubble
1:02.050 intercept Fluffy_Pillow 47.0/130: 36% rage dragon_scales, gaseous_bubble
1:02.050 battle_cry Fluffy_Pillow 57.0/130: 44% rage dragon_scales, gaseous_bubble
1:02.050 neltharions_fury Fluffy_Pillow 57.0/130: 44% rage dragon_scales, battle_cry, gaseous_bubble
1:03.553 shield_slam Fluffy_Pillow 57.0/130: 44% rage dragon_scales, neltharions_fury, battle_cry, gaseous_bubble
1:05.010 ignore_pain Alacastria 79.3/130: 61% rage dragon_scales, neltharions_fury, battle_cry
1:05.010 thunder_clap Fluffy_Pillow 19.3/130: 15% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry
1:06.463 devastate Fluffy_Pillow 20.1/130: 15% rage renewed_fury, ignore_pain, battle_cry
1:07.917 shield_block Fluffy_Pillow 20.1/130: 15% rage renewed_fury, ignore_pain
1:07.917 shield_slam Fluffy_Pillow 10.1/130: 8% rage renewed_fury, ignore_pain, shield_block
1:09.371 revenge Fluffy_Pillow 30.2/130: 23% rage renewed_fury, ignore_pain, shield_block
1:10.825 devastate Fluffy_Pillow 35.5/130: 27% rage renewed_fury, ignore_pain, shield_block
1:12.280 devastate Fluffy_Pillow 35.6/130: 27% rage ignore_pain, shield_block
1:13.736 devastate Fluffy_Pillow 35.6/130: 27% rage ignore_pain, shield_block
1:15.191 shield_slam Fluffy_Pillow 35.8/130: 28% rage ignore_pain, shield_block
1:16.646 auto_attack Fluffy_Pillow 56.0/130: 43% rage raid_movement, ignore_pain, shield_block
1:16.646 devastate Fluffy_Pillow 56.0/130: 43% rage raid_movement, ignore_pain, shield_block
1:18.104 devastate Fluffy_Pillow 56.4/130: 43% rage ignore_pain
1:19.557 devastate Fluffy_Pillow 56.7/130: 44% rage ignore_pain
1:21.013 Waiting 0.800 sec 57.0/130: 44% rage raid_movement
1:21.813 intercept Fluffy_Pillow 57.0/130: 44% rage raid_movement
1:22.050 ignore_pain Alacastria 70.3/130: 54% rage raid_movement, intercept_movement
1:22.050 Waiting 0.200 sec 10.3/130: 8% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
1:22.250 auto_attack Fluffy_Pillow 10.3/130: 8% rage renewed_fury, intercept_movement, ignore_pain
1:22.250 shield_block Fluffy_Pillow 10.3/130: 8% rage renewed_fury, intercept_movement, ignore_pain
1:22.250 revenge Fluffy_Pillow 0.3/130: 0% rage renewed_fury, intercept_movement, ignore_pain, shield_block
1:23.704 shield_slam Fluffy_Pillow 5.3/130: 4% rage renewed_fury, ignore_pain, shield_block
1:25.349 thunder_clap Fluffy_Pillow 25.5/130: 20% rage renewed_fury, dragon_scales, ignore_pain, shield_block
1:26.803 devastate Fluffy_Pillow 25.7/130: 20% rage renewed_fury, dragon_scales, ignore_pain, shield_block
1:28.259 devastate Fluffy_Pillow 26.0/130: 20% rage dragon_scales, ignore_pain, shield_block
1:29.714 devastate Fluffy_Pillow 26.1/130: 20% rage dragon_scales, ignore_pain, shield_block
1:31.170 arcane_torrent Fluffy_Pillow 26.4/130: 20% rage dragon_scales, ignore_pain
1:31.170 revenge Fluffy_Pillow 41.4/130: 32% rage dragon_scales, ignore_pain
1:32.624 auto_attack Fluffy_Pillow 46.6/130: 36% rage raid_movement, dragon_scales, ignore_pain
1:32.624 devastate Fluffy_Pillow 46.6/130: 36% rage raid_movement, dragon_scales, ignore_pain
1:34.079 thunder_clap Fluffy_Pillow 47.4/130: 36% rage dragon_scales, ignore_pain
1:35.533 shield_block Fluffy_Pillow 47.6/130: 37% rage dragon_scales, ignore_pain, mark_of_the_heavy_hide
1:35.533 shield_slam Fluffy_Pillow 37.6/130: 29% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
1:36.990 devastate Fluffy_Pillow 57.7/130: 44% rage ignore_pain, shield_block, mark_of_the_heavy_hide
1:38.444 shield_slam Fluffy_Pillow 59.1/130: 45% rage shield_block, mark_of_the_heavy_hide
1:39.898 ignore_pain Alacastria 80.3/130: 62% rage shield_block, mark_of_the_heavy_hide
1:39.898 revenge Fluffy_Pillow 20.3/130: 16% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:41.353 devastate Fluffy_Pillow 25.6/130: 20% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:42.807 intercept Fluffy_Pillow 25.8/130: 20% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:42.807 shield_slam Fluffy_Pillow 35.8/130: 28% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
1:44.261 devastate Fluffy_Pillow 55.9/130: 43% rage renewed_fury, ignore_pain, shield_block
1:45.716 devastate Fluffy_Pillow 56.0/130: 43% rage renewed_fury, ignore_pain, shield_block
1:47.171 devastate Fluffy_Pillow 56.2/130: 43% rage ignore_pain
1:48.623 revenge Fluffy_Pillow 56.5/130: 43% rage raid_movement, ignore_pain
1:50.077 ignore_pain Alacastria 61.9/130: 48% rage raid_movement, ignore_pain
1:50.077 Waiting 2.900 sec 1.9/130: 1% rage raid_movement, renewed_fury, ignore_pain
1:52.977 auto_attack Fluffy_Pillow 1.9/130: 1% rage raid_movement, renewed_fury, ignore_pain
1:52.977 revenge Fluffy_Pillow 1.9/130: 1% rage raid_movement, renewed_fury, ignore_pain
1:54.432 thunder_clap Fluffy_Pillow 7.0/130: 5% rage renewed_fury, ignore_pain
1:55.886 devastate Fluffy_Pillow 7.0/130: 5% rage renewed_fury, ignore_pain
1:57.341 devastate Fluffy_Pillow 7.4/130: 6% rage dragon_scales, ignore_pain
1:58.796 devastate Fluffy_Pillow 7.8/130: 6% rage dragon_scales, ignore_pain
2:00.251 use_item_giant_ornamental_pearl Fluffy_Pillow 8.1/130: 6% rage dragon_scales, ignore_pain
2:00.294 thunder_clap Fluffy_Pillow 8.1/130: 6% rage dragon_scales, ignore_pain, gaseous_bubble
2:01.747 revenge Fluffy_Pillow 8.1/130: 6% rage dragon_scales, ignore_pain, gaseous_bubble
2:03.203 intercept Fluffy_Pillow 13.1/130: 10% rage dragon_scales, ignore_pain, gaseous_bubble
2:03.203 shield_block Fluffy_Pillow 23.1/130: 18% rage dragon_scales, ignore_pain, gaseous_bubble
2:03.203 battle_cry Fluffy_Pillow 13.1/130: 10% rage dragon_scales, ignore_pain, shield_block, gaseous_bubble
2:03.203 demoralizing_shout Fluffy_Pillow 13.1/130: 10% rage dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:03.203 ignore_pain Alacastria 63.1/130: 49% rage demoralizing_shout, dragon_scales, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:03.203 neltharions_fury Fluffy_Pillow 3.1/130: 2% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:04.707 shield_slam Fluffy_Pillow 3.1/130: 2% rage raid_movement, renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, shield_block, gaseous_bubble
2:06.160 revenge Fluffy_Pillow 23.1/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, shield_block, gaseous_bubble
2:07.615 thunder_clap Fluffy_Pillow 28.1/130: 22% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble
2:09.070 devastate Fluffy_Pillow 28.4/130: 22% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
2:10.526 devastate Fluffy_Pillow 28.7/130: 22% rage demoralizing_shout, ignore_pain, shield_block
2:11.981 devastate Fluffy_Pillow 28.7/130: 22% rage ignore_pain
2:13.434 devastate Fluffy_Pillow 29.2/130: 22% rage ignore_pain
2:14.887 revenge Fluffy_Pillow 29.7/130: 23% rage ignore_pain, mark_of_the_heavy_hide
2:16.342 shield_block Fluffy_Pillow 35.1/130: 27% rage ignore_pain, mark_of_the_heavy_hide
2:16.342 shield_slam Fluffy_Pillow 25.1/130: 19% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:17.795 devastate Fluffy_Pillow 45.1/130: 35% rage ignore_pain, shield_block, mark_of_the_heavy_hide
2:19.250 devastate Fluffy_Pillow 45.2/130: 35% rage shield_block, mark_of_the_heavy_hide
2:20.704 shield_slam Fluffy_Pillow 47.5/130: 37% rage shield_block, mark_of_the_heavy_hide
2:22.159 ignore_pain Alacastria 69.9/130: 54% rage shield_block, mark_of_the_heavy_hide
2:22.159 revenge Fluffy_Pillow 9.9/130: 8% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:23.613 intercept Fluffy_Pillow 14.9/130: 11% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:23.613 thunder_clap Fluffy_Pillow 24.9/130: 19% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:25.068 devastate Fluffy_Pillow 25.2/130: 19% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
2:26.524 devastate Fluffy_Pillow 25.4/130: 20% rage renewed_fury, dragon_scales, ignore_pain, mark_of_the_heavy_hide
2:27.978 devastate Fluffy_Pillow 25.4/130: 20% rage renewed_fury, dragon_scales, ignore_pain, mark_of_the_heavy_hide
2:29.434 shield_block Fluffy_Pillow 25.7/130: 20% rage dragon_scales, ignore_pain
2:29.434 shield_slam Fluffy_Pillow 15.7/130: 12% rage dragon_scales, ignore_pain, shield_block
2:30.888 revenge Fluffy_Pillow 35.9/130: 28% rage dragon_scales, ignore_pain, shield_block
2:32.343 thunder_clap Fluffy_Pillow 41.3/130: 32% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:33.798 devastate Fluffy_Pillow 41.3/130: 32% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:35.251 devastate Fluffy_Pillow 41.7/130: 32% rage dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:36.704 auto_attack Fluffy_Pillow 41.8/130: 32% rage raid_movement, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:36.704 devastate Fluffy_Pillow 41.8/130: 32% rage raid_movement, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
2:38.158 shield_slam Fluffy_Pillow 43.0/130: 33% rage mark_of_the_heavy_hide
2:39.612 ignore_pain Alacastria 63.0/130: 48% rage mark_of_the_heavy_hide
2:39.612 revenge Fluffy_Pillow 3.0/130: 2% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
2:41.067 devastate Fluffy_Pillow 8.2/130: 6% rage renewed_fury, ignore_pain
2:42.521 devastate Fluffy_Pillow 8.6/130: 7% rage renewed_fury, ignore_pain
2:43.975 intercept Fluffy_Pillow 8.6/130: 7% rage renewed_fury, ignore_pain
2:43.975 shield_block Fluffy_Pillow 18.6/130: 14% rage renewed_fury, ignore_pain
2:43.975 devastate Fluffy_Pillow 8.6/130: 7% rage renewed_fury, ignore_pain, shield_block
2:45.429 devastate Fluffy_Pillow 8.9/130: 7% rage renewed_fury, dragon_scales, ignore_pain, shield_block
2:46.883 shield_slam Fluffy_Pillow 9.1/130: 7% rage dragon_scales, ignore_pain, shield_block
2:48.337 devastate Fluffy_Pillow 29.2/130: 22% rage dragon_scales, ignore_pain, shield_block
2:49.794 devastate Fluffy_Pillow 29.4/130: 23% rage dragon_scales, ignore_pain, shield_block
2:51.248 Waiting 1.000 sec 29.7/130: 23% rage raid_movement, dragon_scales, ignore_pain, shield_block
2:52.248 auto_attack Fluffy_Pillow 30.1/130: 23% rage raid_movement, dragon_scales, ignore_pain
2:52.248 revenge Fluffy_Pillow 30.1/130: 23% rage raid_movement, dragon_scales, ignore_pain
2:53.701 thunder_clap Fluffy_Pillow 35.2/130: 27% rage dragon_scales, ignore_pain
2:55.156 devastate Fluffy_Pillow 36.8/130: 28% rage dragon_scales
2:56.611 shield_block Fluffy_Pillow 40.8/130: 31% rage
2:56.611 shield_slam Fluffy_Pillow 30.8/130: 24% rage shield_block
2:58.068 devastate Fluffy_Pillow 54.7/130: 42% rage shield_block
2:59.523 thunder_clap Fluffy_Pillow 55.9/130: 43% rage shield_block
3:00.977 use_item_giant_ornamental_pearl Fluffy_Pillow 55.9/130: 43% rage shield_block
3:00.977 arcane_torrent Fluffy_Pillow 55.9/130: 43% rage shield_block, gaseous_bubble
3:01.170 ignore_pain Alacastria 70.9/130: 55% rage shield_block, gaseous_bubble
3:01.170 revenge Fluffy_Pillow 10.9/130: 8% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:02.624 devastate Fluffy_Pillow 15.9/130: 12% rage renewed_fury, ignore_pain, shield_block, gaseous_bubble
3:04.078 intercept Fluffy_Pillow 16.0/130: 12% rage renewed_fury, ignore_pain, shield_block
3:04.078 battle_cry Fluffy_Pillow 26.0/130: 20% rage renewed_fury, ignore_pain, shield_block
3:04.078 neltharions_fury Fluffy_Pillow 26.0/130: 20% rage renewed_fury, ignore_pain, battle_cry, shield_block
3:05.581 shield_slam Fluffy_Pillow 26.1/130: 20% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry
3:07.036 thunder_clap Fluffy_Pillow 46.5/130: 36% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry
3:08.491 Waiting 0.100 sec 46.8/130: 36% rage raid_movement, ignore_pain, battle_cry
3:08.591 devastate Fluffy_Pillow 46.8/130: 36% rage raid_movement, ignore_pain, battle_cry
3:10.045 shield_block Fluffy_Pillow 47.0/130: 36% rage ignore_pain
3:10.045 shield_slam Fluffy_Pillow 37.0/130: 28% rage ignore_pain, shield_block
3:11.499 devastate Fluffy_Pillow 57.2/130: 44% rage ignore_pain, shield_block
3:12.952 shield_slam Fluffy_Pillow 57.2/130: 44% rage ignore_pain, shield_block
3:14.406 ignore_pain Alacastria 77.4/130: 60% rage ignore_pain, shield_block
3:14.406 devastate Fluffy_Pillow 17.4/130: 13% rage renewed_fury, ignore_pain, shield_block
3:15.861 shield_slam Fluffy_Pillow 17.4/130: 13% rage renewed_fury, ignore_pain, shield_block
3:17.314 devastate Fluffy_Pillow 37.6/130: 29% rage renewed_fury, ignore_pain, shield_block
3:18.768 shield_slam Fluffy_Pillow 37.9/130: 29% rage renewed_fury, ignore_pain, shield_block
3:20.223 Waiting 2.800 sec 58.0/130: 45% rage raid_movement, renewed_fury, ignore_pain, shield_block
3:23.023 auto_attack Fluffy_Pillow 58.1/130: 45% rage raid_movement, ignore_pain
3:23.023 revenge Fluffy_Pillow 58.1/130: 45% rage raid_movement, ignore_pain
3:24.478 intercept Fluffy_Pillow 63.5/130: 49% rage raid_movement, ignore_pain
3:24.478 ignore_pain Alacastria 73.5/130: 57% rage raid_movement, intercept_movement, ignore_pain
3:24.478 Waiting 0.100 sec 13.5/130: 10% rage raid_movement, renewed_fury, intercept_movement, ignore_pain
3:24.578 shield_block Fluffy_Pillow 13.5/130: 10% rage renewed_fury, intercept_movement, ignore_pain
3:24.578 thunder_clap Fluffy_Pillow 3.5/130: 3% rage renewed_fury, intercept_movement, ignore_pain, shield_block
3:26.035 devastate Fluffy_Pillow 3.6/130: 3% rage renewed_fury, ignore_pain, shield_block
3:27.489 shield_slam Fluffy_Pillow 3.6/130: 3% rage renewed_fury, ignore_pain, shield_block
3:28.944 revenge Fluffy_Pillow 23.6/130: 18% rage renewed_fury, ignore_pain, shield_block
3:30.398 thunder_clap Fluffy_Pillow 29.1/130: 22% rage renewed_fury, ignore_pain, shield_block
3:31.851 devastate Fluffy_Pillow 29.1/130: 22% rage ignore_pain, shield_block
3:33.306 shield_slam Fluffy_Pillow 29.4/130: 23% rage ignore_pain
3:34.760 devastate Fluffy_Pillow 49.9/130: 38% rage ignore_pain
3:36.215 revenge Fluffy_Pillow 50.1/130: 39% rage ignore_pain
3:37.667 shield_block Fluffy_Pillow 55.1/130: 42% rage ignore_pain
3:37.667 thunder_clap Fluffy_Pillow 45.1/130: 35% rage ignore_pain, shield_block
3:39.122 devastate Fluffy_Pillow 45.5/130: 35% rage ignore_pain, shield_block
3:40.577 shield_slam Fluffy_Pillow 48.3/130: 37% rage raid_movement, shield_block, mark_of_the_heavy_hide
3:42.029 ignore_pain Alacastria 70.3/130: 54% rage shield_block, mark_of_the_heavy_hide
3:42.029 devastate Fluffy_Pillow 10.3/130: 8% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:43.483 devastate Fluffy_Pillow 10.4/130: 8% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:44.938 intercept Fluffy_Pillow 10.7/130: 8% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:44.938 shield_slam Fluffy_Pillow 20.7/130: 16% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:46.392 devastate Fluffy_Pillow 41.0/130: 32% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide
3:47.847 revenge Fluffy_Pillow 41.0/130: 32% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
3:49.302 revenge Fluffy_Pillow 46.4/130: 36% rage ignore_pain, mark_of_the_heavy_hide
3:50.757 Waiting 2.200 sec 51.7/130: 40% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
3:52.957 auto_attack Fluffy_Pillow 51.9/130: 40% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
3:52.957 devastate Fluffy_Pillow 51.9/130: 40% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
3:54.412 shield_block Fluffy_Pillow 52.2/130: 40% rage ignore_pain, mark_of_the_heavy_hide
3:54.412 shield_slam Fluffy_Pillow 42.2/130: 32% rage ignore_pain, shield_block, mark_of_the_heavy_hide
3:55.866 ignore_pain Alacastria 62.2/130: 48% rage ignore_pain, shield_block
3:55.866 thunder_clap Fluffy_Pillow 2.2/130: 2% rage renewed_fury, ignore_pain, shield_block
3:57.320 devastate Fluffy_Pillow 2.3/130: 2% rage renewed_fury, dragon_scales, ignore_pain, shield_block
3:58.774 revenge Fluffy_Pillow 2.5/130: 2% rage renewed_fury, dragon_scales, ignore_pain, shield_block
4:00.229 devastate Fluffy_Pillow 7.9/130: 6% rage renewed_fury, dragon_scales, ignore_pain, shield_block
4:01.685 use_item_giant_ornamental_pearl Fluffy_Pillow 7.9/130: 6% rage renewed_fury, dragon_scales, ignore_pain, shield_block, mark_of_the_heavy_hide
4:01.685 thunder_clap Fluffy_Pillow 7.9/130: 6% rage renewed_fury, dragon_scales, ignore_pain, shield_block, gaseous_bubble, mark_of_the_heavy_hide
4:03.138 shield_slam Fluffy_Pillow 7.9/130: 6% rage dragon_scales, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
4:04.592 battle_cry Fluffy_Pillow 27.9/130: 21% rage dragon_scales, ignore_pain, gaseous_bubble, mark_of_the_heavy_hide
4:04.592 demoralizing_shout Fluffy_Pillow 27.9/130: 21% rage dragon_scales, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:04.592 ignore_pain Alacastria 77.9/130: 60% rage demoralizing_shout, dragon_scales, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:04.592 neltharions_fury Fluffy_Pillow 17.9/130: 14% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:06.096 intercept Fluffy_Pillow 17.9/130: 14% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:06.096 revenge Fluffy_Pillow 27.9/130: 21% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:07.549 thunder_clap Fluffy_Pillow 32.9/130: 25% rage renewed_fury, demoralizing_shout, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:09.004 shield_block Fluffy_Pillow 32.9/130: 25% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, gaseous_bubble, mark_of_the_heavy_hide
4:09.004 devastate Fluffy_Pillow 22.9/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
4:10.459 shield_slam Fluffy_Pillow 23.0/130: 18% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block
4:11.912 devastate Fluffy_Pillow 43.1/130: 33% rage demoralizing_shout, ignore_pain, shield_block
4:13.368 auto_attack Fluffy_Pillow 43.4/130: 33% rage ignore_pain, shield_block
4:13.368 shield_slam Fluffy_Pillow 43.4/130: 33% rage ignore_pain, shield_block
4:14.821 ignore_pain Alacastria 63.7/130: 49% rage ignore_pain, shield_block
4:14.821 devastate Fluffy_Pillow 3.7/130: 3% rage renewed_fury, ignore_pain, shield_block
4:16.275 devastate Fluffy_Pillow 4.0/130: 3% rage renewed_fury, ignore_pain, shield_block
4:17.730 devastate Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain, shield_block
4:19.184 revenge Fluffy_Pillow 4.6/130: 4% rage renewed_fury, ignore_pain
4:20.636 Waiting 2.400 sec 9.9/130: 8% rage raid_movement, renewed_fury, ignore_pain
4:23.036 auto_attack Fluffy_Pillow 10.4/130: 8% rage raid_movement, ignore_pain
4:23.036 devastate Fluffy_Pillow 10.4/130: 8% rage raid_movement, ignore_pain
4:24.492 shield_block Fluffy_Pillow 10.9/130: 8% rage ignore_pain
4:24.492 shield_slam Fluffy_Pillow 0.9/130: 1% rage ignore_pain, shield_block
4:25.947 intercept Fluffy_Pillow 21.2/130: 16% rage ignore_pain, shield_block
4:26.096 thunder_clap Fluffy_Pillow 31.5/130: 24% rage dragon_scales, ignore_pain, shield_block
4:27.550 devastate Fluffy_Pillow 31.6/130: 24% rage dragon_scales, ignore_pain, shield_block
4:29.005 auto_attack Fluffy_Pillow 32.0/130: 25% rage raid_movement, dragon_scales, ignore_pain, shield_block
4:29.005 revenge Fluffy_Pillow 32.0/130: 25% rage raid_movement, dragon_scales, ignore_pain, shield_block
4:30.460 devastate Fluffy_Pillow 39.9/130: 31% rage dragon_scales, shield_block
4:31.915 arcane_torrent Fluffy_Pillow 39.9/130: 31% rage dragon_scales, shield_block
4:31.915 shield_slam Fluffy_Pillow 54.9/130: 42% rage dragon_scales, shield_block
4:33.369 ignore_pain Alacastria 76.2/130: 59% rage dragon_scales, shield_block
4:33.369 thunder_clap Fluffy_Pillow 16.2/130: 12% rage renewed_fury, ignore_pain, shield_block
4:34.824 devastate Fluffy_Pillow 16.5/130: 13% rage renewed_fury, ignore_pain
4:36.278 devastate Fluffy_Pillow 16.8/130: 13% rage renewed_fury, ignore_pain
4:37.733 shield_block Fluffy_Pillow 16.8/130: 13% rage renewed_fury, ignore_pain
4:37.733 revenge Fluffy_Pillow 6.8/130: 5% rage renewed_fury, ignore_pain, shield_block
4:39.188 thunder_clap Fluffy_Pillow 12.0/130: 9% rage renewed_fury, ignore_pain, shield_block
4:40.642 shield_slam Fluffy_Pillow 12.1/130: 9% rage ignore_pain, shield_block
4:42.098 devastate Fluffy_Pillow 32.3/130: 25% rage ignore_pain, shield_block
4:43.553 devastate Fluffy_Pillow 32.3/130: 25% rage ignore_pain, shield_block
4:45.008 auto_attack Fluffy_Pillow 32.5/130: 25% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
4:45.008 devastate Fluffy_Pillow 32.5/130: 25% rage raid_movement, ignore_pain, shield_block, mark_of_the_heavy_hide
4:46.462 intercept Fluffy_Pillow 32.8/130: 25% rage ignore_pain, mark_of_the_heavy_hide
4:46.462 shield_slam Fluffy_Pillow 42.8/130: 33% rage ignore_pain, mark_of_the_heavy_hide
4:47.916 ignore_pain Alacastria 62.8/130: 48% rage ignore_pain, mark_of_the_heavy_hide
4:47.916 devastate Fluffy_Pillow 2.8/130: 2% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:49.371 revenge Fluffy_Pillow 2.8/130: 2% rage renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:50.825 Waiting 2.100 sec 8.1/130: 6% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:52.925 auto_attack Fluffy_Pillow 8.2/130: 6% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:52.925 revenge Fluffy_Pillow 8.2/130: 6% rage raid_movement, renewed_fury, ignore_pain, mark_of_the_heavy_hide
4:54.380 shield_block Fluffy_Pillow 13.7/130: 11% rage ignore_pain
4:54.380 shield_slam Fluffy_Pillow 3.7/130: 3% rage ignore_pain, shield_block
4:55.833 thunder_clap Fluffy_Pillow 23.7/130: 18% rage ignore_pain, shield_block
4:57.288 devastate Fluffy_Pillow 24.1/130: 19% rage ignore_pain, shield_block
4:58.745 devastate Fluffy_Pillow 24.3/130: 19% rage ignore_pain, shield_block
5:00.199 Waiting 0.400 sec 24.6/130: 19% rage raid_movement, ignore_pain, shield_block
5:00.599 auto_attack Fluffy_Pillow 24.6/130: 19% rage raid_movement, ignore_pain, shield_block
5:00.599 shield_slam Fluffy_Pillow 24.6/130: 19% rage raid_movement, ignore_pain, shield_block
5:02.054 use_item_giant_ornamental_pearl Fluffy_Pillow 44.8/130: 34% rage dragon_scales, ignore_pain, shield_block
5:02.054 revenge Fluffy_Pillow 44.8/130: 34% rage dragon_scales, ignore_pain, shield_block, gaseous_bubble
5:03.509 thunder_clap Fluffy_Pillow 49.8/130: 38% rage dragon_scales, gaseous_bubble
5:04.964 battle_cry Fluffy_Pillow 49.8/130: 38% rage dragon_scales, gaseous_bubble
5:04.964 neltharions_fury Fluffy_Pillow 49.8/130: 38% rage dragon_scales, battle_cry, gaseous_bubble
5:06.468 intercept Fluffy_Pillow 49.8/130: 38% rage dragon_scales, neltharions_fury, battle_cry, gaseous_bubble
5:06.468 revenge Fluffy_Pillow 59.8/130: 46% rage dragon_scales, neltharions_fury, battle_cry, gaseous_bubble
5:07.921 ignore_pain Alacastria 64.8/130: 50% rage dragon_scales, neltharions_fury, battle_cry, gaseous_bubble
5:07.921 devastate Fluffy_Pillow 4.8/130: 4% rage renewed_fury, ignore_pain, neltharions_fury, battle_cry, gaseous_bubble
5:09.377 thunder_clap Fluffy_Pillow 5.2/130: 4% rage renewed_fury, ignore_pain, battle_cry
5:10.830 devastate Fluffy_Pillow 5.5/130: 4% rage renewed_fury, ignore_pain
5:12.283 devastate Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain
5:13.738 devastate Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain
5:15.193 revenge Fluffy_Pillow 6.1/130: 5% rage ignore_pain
5:16.648 devastate Fluffy_Pillow 11.3/130: 9% rage raid_movement, ignore_pain, mark_of_the_heavy_hide
5:18.101 shield_block Fluffy_Pillow 11.5/130: 9% rage ignore_pain, mark_of_the_heavy_hide
5:18.101 shield_slam Fluffy_Pillow 1.5/130: 1% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:19.556 devastate Fluffy_Pillow 21.5/130: 17% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:21.011 devastate Fluffy_Pillow 21.5/130: 17% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:22.465 devastate Fluffy_Pillow 21.6/130: 17% rage ignore_pain, shield_block, mark_of_the_heavy_hide
5:23.918 shield_slam Fluffy_Pillow 21.6/130: 17% rage shield_block, mark_of_the_heavy_hide
5:25.372 devastate Fluffy_Pillow 43.5/130: 33% rage shield_block, mark_of_the_heavy_hide
5:26.826 intercept Fluffy_Pillow 47.1/130: 36% rage shield_block
5:26.826 devastate Fluffy_Pillow 57.1/130: 44% rage shield_block
5:28.281 ignore_pain Alacastria 60.7/130: 47% rage
5:28.281 devastate Fluffy_Pillow 0.7/130: 1% rage renewed_fury, ignore_pain
5:29.736 revenge Fluffy_Pillow 0.7/130: 1% rage renewed_fury, ignore_pain
5:31.191 devastate Fluffy_Pillow 5.8/130: 4% rage renewed_fury, ignore_pain
5:32.647 devastate Fluffy_Pillow 6.2/130: 5% rage raid_movement, renewed_fury, ignore_pain
5:34.102 devastate Fluffy_Pillow 6.6/130: 5% rage renewed_fury, ignore_pain
5:35.555 devastate Fluffy_Pillow 6.7/130: 5% rage ignore_pain
5:37.009 devastate Fluffy_Pillow 7.0/130: 5% rage ignore_pain
5:38.462 revenge Fluffy_Pillow 7.1/130: 5% rage ignore_pain
5:39.917 shield_block Fluffy_Pillow 12.5/130: 10% rage ignore_pain
5:39.917 shield_slam Fluffy_Pillow 2.5/130: 2% rage ignore_pain, shield_block
5:41.373 devastate Fluffy_Pillow 22.9/130: 18% rage ignore_pain, shield_block
5:42.827 devastate Fluffy_Pillow 23.1/130: 18% rage ignore_pain, shield_block
5:44.282 devastate Fluffy_Pillow 25.4/130: 20% rage shield_block
5:45.737 devastate Fluffy_Pillow 26.7/130: 21% rage shield_block
5:47.190 intercept Fluffy_Pillow 30.6/130: 24% rage dragon_scales, shield_block
5:47.190 revenge Fluffy_Pillow 40.6/130: 31% rage dragon_scales, shield_block
5:48.645 auto_attack Fluffy_Pillow 49.0/130: 38% rage raid_movement, dragon_scales
5:48.645 shield_slam Fluffy_Pillow 49.0/130: 38% rage raid_movement, dragon_scales
5:50.099 ignore_pain Alacastria 73.7/130: 57% rage dragon_scales
5:50.099 devastate Fluffy_Pillow 13.7/130: 11% rage renewed_fury, ignore_pain
5:51.553 devastate Fluffy_Pillow 13.8/130: 11% rage renewed_fury, ignore_pain
5:53.007 shield_block Fluffy_Pillow 14.2/130: 11% rage renewed_fury, ignore_pain
5:53.007 devastate Fluffy_Pillow 4.2/130: 3% rage renewed_fury, ignore_pain, shield_block
5:54.461 shield_slam Fluffy_Pillow 4.3/130: 3% rage renewed_fury, ignore_pain, shield_block
5:55.915 devastate Fluffy_Pillow 24.5/130: 19% rage renewed_fury, ignore_pain, shield_block
5:57.370 devastate Fluffy_Pillow 24.5/130: 19% rage ignore_pain, shield_block
5:58.823 devastate Fluffy_Pillow 24.7/130: 19% rage ignore_pain, shield_block
6:00.279 revenge Fluffy_Pillow 25.0/130: 19% rage ignore_pain, shield_block
6:01.734 arcane_torrent Fluffy_Pillow 30.0/130: 23% rage ignore_pain
6:01.915 use_item_giant_ornamental_pearl Fluffy_Pillow 45.0/130: 35% rage ignore_pain
6:02.054 devastate Fluffy_Pillow 45.3/130: 35% rage ignore_pain, gaseous_bubble
6:03.509 devastate Fluffy_Pillow 45.3/130: 35% rage ignore_pain, gaseous_bubble
6:04.963 devastate Fluffy_Pillow 45.3/130: 35% rage raid_movement, ignore_pain, gaseous_bubble
6:06.418 shield_block Fluffy_Pillow 45.3/130: 35% rage gaseous_bubble, mark_of_the_heavy_hide
6:06.418 battle_cry Fluffy_Pillow 35.3/130: 27% rage shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:06.418 demoralizing_shout Fluffy_Pillow 35.3/130: 27% rage battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:06.418 ignore_pain Alacastria 85.3/130: 66% rage demoralizing_shout, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:06.418 shield_slam Fluffy_Pillow 25.3/130: 19% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:07.873 intercept Fluffy_Pillow 45.3/130: 35% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:07.873 devastate Fluffy_Pillow 55.3/130: 43% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, gaseous_bubble, mark_of_the_heavy_hide
6:09.329 devastate Fluffy_Pillow 55.3/130: 43% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, mark_of_the_heavy_hide
6:10.782 shield_slam Fluffy_Pillow 55.4/130: 43% rage renewed_fury, demoralizing_shout, ignore_pain, battle_cry, shield_block, mark_of_the_heavy_hide
6:12.237 ignore_pain Alacastria 75.4/130: 58% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, mark_of_the_heavy_hide
6:12.237 potion Fluffy_Pillow 15.4/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, mark_of_the_heavy_hide
6:12.237 devastate Fluffy_Pillow 15.4/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:13.693 shield_slam Fluffy_Pillow 15.4/130: 12% rage renewed_fury, demoralizing_shout, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:15.147 devastate Fluffy_Pillow 35.6/130: 27% rage renewed_fury, ignore_pain, shield_block, mark_of_the_heavy_hide, unbending_potion
6:16.601 shield_slam Fluffy_Pillow 36.1/130: 28% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:18.057 devastate Fluffy_Pillow 56.3/130: 43% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:19.513 shield_block Fluffy_Pillow 56.4/130: 43% rage ignore_pain, unbending_potion
6:19.513 devastate Fluffy_Pillow 46.4/130: 36% rage ignore_pain, shield_block, unbending_potion
6:20.967 auto_attack Fluffy_Pillow 46.7/130: 36% rage raid_movement, ignore_pain, shield_block, unbending_potion
6:20.967 devastate Fluffy_Pillow 46.7/130: 36% rage raid_movement, ignore_pain, shield_block, unbending_potion
6:22.422 revenge Fluffy_Pillow 46.8/130: 36% rage ignore_pain, shield_block, unbending_potion
6:23.877 devastate Fluffy_Pillow 51.8/130: 40% rage ignore_pain, shield_block, unbending_potion
6:25.331 shield_slam Fluffy_Pillow 52.1/130: 40% rage ignore_pain, shield_block, unbending_potion
6:26.786 ignore_pain Alacastria 72.4/130: 56% rage ignore_pain, shield_block, unbending_potion
6:26.786 devastate Fluffy_Pillow 12.4/130: 10% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:28.241 intercept Fluffy_Pillow 12.7/130: 10% rage renewed_fury, ignore_pain, unbending_potion
6:28.241 shield_slam Fluffy_Pillow 22.7/130: 17% rage renewed_fury, ignore_pain, unbending_potion
6:29.696 devastate Fluffy_Pillow 42.7/130: 33% rage renewed_fury, ignore_pain, unbending_potion
6:31.151 revenge Fluffy_Pillow 43.1/130: 33% rage renewed_fury, ignore_pain, unbending_potion
6:32.606 shield_block Fluffy_Pillow 48.5/130: 37% rage renewed_fury, ignore_pain, unbending_potion
6:32.606 shield_slam Fluffy_Pillow 38.5/130: 30% rage renewed_fury, ignore_pain, shield_block, unbending_potion
6:34.060 devastate Fluffy_Pillow 58.7/130: 45% rage ignore_pain, shield_block, unbending_potion

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 22715 21090 10861 (8941)
Agility 6579 6254 0
Stamina 41306 41306 19030
Intellect 5328 5003 0
Spirit 2 2 0
Health 2478360 2478360 0
Rage 130 130 0
Crit 12.08% 12.08% 2129
Haste 3.41% 3.41% 1107
Damage / Heal Versatility 15.80% 14.86% 5945
Mitigation Versatility 7.90% 7.43% 5945
Attack Power 30563 28377 0
Mastery 51.83% 51.83% 9292
Armor 4256 4256 4015
Run Speed 7 0 0
Leech 2.39% 2.39% 549
Avoidance 0 0 404
Tank-Miss 3.00% 3.00% 0
Tank-Dodge 3.00% 3.00% 0
Tank-Parry 17.05% 15.94% 2129
Tank-Block 30.56% 30.56% 0
Tank-Crit -6.00% -6.00% 0

Gear

Source Slot Average Item Level: 850.00
Local Head Subterranean Horror Faceguard
ilevel: 845, stats: { 548 Armor, +1238 StrInt, +1857 Sta, +777 Mastery, +503 Haste, +549 Leech }
Local Neck Krakentooth Necklace
ilevel: 860, stats: { +1201 Sta, +1307 Mastery, +599 Vers }, enchant: mark_of_the_heavy_hide
Local Shoulders Wardbreaker Pauldrons
ilevel: 845, stats: { 506 Armor, +929 StrInt, +1393 Sta, +625 Vers, +336 Mastery }, gems: { +200 Str }
Local Chest Demonsteel Breastplate of the Harmonious
ilevel: 845, stats: { 675 Armor, +1857 Sta, +1238 StrInt, +549 Mastery, +732 Vers }
Local Waist Greatbelt of Disruption
ilevel: 850, stats: { 384 Armor, +973 StrInt, +1459 Sta, +594 Vers, +385 Mastery }
Local Legs Arcane Defender's Pants
ilevel: 840, stats: { 584 Armor, +1182 StrInt, +1773 Sta, +899 Mastery, +359 Haste }
Local Feet Leadfoot Earthshakers
ilevel: 845, stats: { 464 Armor, +929 StrInt, +1393 Sta, +666 Mastery, +295 Vers }
Local Wrists Dragonbone Wristclamps
ilevel: 855, stats: { 302 Armor, +1147 Sta, +765 StrInt, +502 Mastery, +245 Haste }
Local Hands Coralplate Gauntlets
ilevel: 840, stats: { 417 Armor, +886 StrInt, +1329 Sta, +613 Mastery, +330 Vers }
Local Finger1 Braided Silver Ring
ilevel: 850, stats: { +1094 Sta, +997 Mastery, +839 Vers }, gems: { +150 Mastery }, enchant: { +200 Mastery }
Local Finger2 Loop of Eightfold Eyes
ilevel: 845, stats: { +1045 Sta, +1236 Mastery, +566 Vers }, enchant: { +200 Vers }
Local Trinket1 Giant Ornamental Pearl
ilevel: 850, stats: { +932 Vers }
Local Trinket2 Writhing Heart of Darkness
ilevel: 840, stats: { +404 Avoidance, +898 Crit }
Local Back Drape of the Mana-Starved
ilevel: 860, stats: { 135 Armor, +1201 Sta, +801 StrAgiInt, +528 Crit, +233 Vers }, enchant: { +200 Str }
Local Main Hand Scaleshard
ilevel: 868, weapon: { 3897 - 7239, 2.6 }, stats: { +657 Str, +986 Sta, +304 Crit, +292 Mastery }
Local Off Hand Scale of the Earth-Warder
ilevel: 868, stats: { +863 Str, +1295 Sta, +399 Crit, +383 Mastery }, relics: { +40 ilevels, +42 ilevels, +36 ilevels }

Talents

Level
15 Shockwave (Protection Warrior) Storm Bolt (Protection Warrior) Warbringer (Protection Warrior)
30 Impending Victory (Protection Warrior) Inspiring Presence (Protection Warrior) Safeguard (Protection Warrior)
45 Renewed Fury (Protection Warrior) Ultimatum (Protection Warrior) Avatar
60 Warlord's Challenge (Protection Warrior) Bounding Stride Crackling Thunder (Protection Warrior)
75 Best Served Cold (Protection Warrior) Never Surrender (Protection Warrior) Indomitable (Protection Warrior)
90 Vengeance (Protection Warrior) Into the Fray (Protection Warrior) Booming Voice (Protection Warrior)
100 Anger Management Heavy Repercussions (Protection Warrior) Ravager (Protection Warrior)

Profile

warrior="Alacastria"
origin="https://us.api.battle.net/wow/character/thrall/Alacastria/advanced"
thumbnail="http://us.battle.net/static-render/us/thrall/45/155500077-avatar.jpg"
level=110
race=blood_elf
role=tank
position=front
professions=blacksmithing=758/mining=784
talents=1213332
artifact=11:0:0:0:0:91:1:93:1:95:3:98:2:99:1:100:3:101:3:102:3:103:1:104:1:1358:1
spec=protection

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=flask,type=countless_armies
actions.precombat+=/food,type=seedbattered_fish_plate
actions.precombat+=/augmentation,type=defiled
# Snapshot raid buffed stats before combat begins and pre-potting is done.
actions.precombat+=/snapshot_stats
actions.precombat+=/potion,name=unbending_potion

# Executed every time the actor is available.
actions=intercept
actions+=/auto_attack
actions+=/use_item,name=giant_ornamental_pearl
actions+=/blood_fury
actions+=/berserking
actions+=/arcane_torrent
actions+=/call_action_list,name=prot

actions.prot=shield_block,if=!buff.neltharions_fury.up&((cooldown.shield_slam.remains<6&!buff.shield_block.up)|(cooldown.shield_slam.remains<6+buff.shield_block.remains&buff.shield_block.up))
actions.prot+=/ignore_pain,if=(rage>=60&!talent.vengeance.enabled)|(buff.vengeance_ignore_pain.up&buff.ultimatum.up)|(buff.vengeance_ignore_pain.up&rage>=39)|(talent.vengeance.enabled&!buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage<30)
actions.prot+=/focused_rage,if=(buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(buff.ultimatum.up&buff.vengeance_focused_rage.up&!buff.vengeance_ignore_pain.up)|(talent.vengeance.enabled&buff.ultimatum.up&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up)|(talent.vengeance.enabled&!buff.vengeance_ignore_pain.up&!buff.vengeance_focused_rage.up&rage>=30)|(buff.ultimatum.up&buff.vengeance_ignore_pain.up&cooldown.shield_slam.remains=0&rage<10)|(rage>=100)
actions.prot+=/demoralizing_shout,if=incoming_damage_2500ms>health.max*0.20
actions.prot+=/shield_wall,if=incoming_damage_2500ms>health.max*0.50
actions.prot+=/last_stand,if=incoming_damage_2500ms>health.max*0.50&!cooldown.shield_wall.remains=0
actions.prot+=/potion,name=unbending_potion,if=(incoming_damage_2500ms>health.max*0.15&!buff.potion.up)|target.time_to_die<=25
actions.prot+=/call_action_list,name=prot_aoe,if=spell_targets.neltharions_fury>=2
actions.prot+=/focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot+=/neltharions_fury,if=incoming_damage_2500ms>health.max*0.20&!buff.shield_block.up
actions.prot+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot+=/revenge,if=cooldown.shield_slam.remains<=gcd.max*2
actions.prot+=/devastate

actions.prot_aoe=focused_rage,if=talent.ultimatum.enabled&buff.ultimatum.up&!talent.vengeance.enabled
actions.prot_aoe+=/battle_cry,if=(talent.vengeance.enabled&talent.ultimatum.enabled&cooldown.shield_slam.remains<=5-gcd.max-0.5)|!talent.vengeance.enabled
actions.prot_aoe+=/demoralizing_shout,if=talent.booming_voice.enabled&buff.battle_cry.up
actions.prot_aoe+=/ravager,if=talent.ravager.enabled&buff.battle_cry.up
actions.prot_aoe+=/neltharions_fury,if=buff.battle_cry.up
actions.prot_aoe+=/shield_slam,if=!(cooldown.shield_block.remains<=gcd.max*2&!buff.shield_block.up&talent.heavy_repercussions.enabled)
actions.prot_aoe+=/revenge
actions.prot_aoe+=/thunder_clap,if=spell_targets.thunder_clap>=3
actions.prot_aoe+=/devastate

head=subterranean_horror_faceguard,id=134511,bonus_id=1727/41/1497/3336
neck=krakentooth_necklace,id=141473,bonus_id=1472,enchant=mark_of_the_heavy_hide
shoulders=wardbreaker_pauldrons,id=136730,bonus_id=1727/1808/1507/3336,gems=200str
back=drape_of_the_manastarved,id=141543,bonus_id=1472,enchant=200str
chest=demonsteel_breastplate,id=123910,bonus_id=689/1715/3408/601/668
wrists=dragonbone_wristclamps,id=138218,bonus_id=1807/1477/3336
hands=coralplate_gauntlets,id=134224,bonus_id=3397/1502/3336
waist=greatbelt_of_disruption,id=137310,bonus_id=3410/1502/3336
legs=arcane_defenders_pants,id=134271,bonus_id=1727/1502/1813
feet=leadfoot_earthshakers,id=134507,bonus_id=1727/1497/3336
finger1=braided_silver_ring,id=134539,bonus_id=3412/1808/1502/1813,gems=150mastery,enchant=200mastery
finger2=loop_of_eightfold_eyes,id=134527,bonus_id=1726/1497/3337,enchant=200vers
trinket1=giant_ornamental_pearl,id=137369,bonus_id=3413/1502/1813
trinket2=writhing_heart_of_darkness,id=137315,bonus_id=1727/40/1492/1813
main_hand=scaleshard,id=128288
off_hand=scale_of_the_earthwarder,id=128289,bonus_id=752,gem_id=136778/137412/137546/0,relic_id=1727:1492:1813/1727:1497:3336/1726:1477/0

# Gear Summary
# gear_ilvl=850.38
# gear_strength=10861
# gear_stamina=19030
# gear_crit_rating=2129
# gear_haste_rating=1107
# gear_mastery_rating=9292
# gear_versatility_rating=5945
# gear_leech_rating=549
# gear_avoidance_rating=404
# gear_armor=4015

Healing_Target : 0 dps, 0 dps to main target, 0 dtps, 0 hps (0 aps), 62.3k TMI, 55.2k ETMI

Results, Spec and Gear

DTPS DTPS Error DTPS Range   TMI TMI Error TMI Min TMI Max TMI Range   MSD Mean MSD Min MSD Max MSD Freq.   Window Bin Size
0.0 0.00 / 0.00% 0 / 0.0%       62.3k 26 / 0.04% 61.1k 65.8k 4.2k / 6.7%       0.0% 0.0% 0.0% INF       6.00s 0.50s
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Health 97.63% 0.0 100.0% 100%
Talents
Scale Factors for Healing_Target Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Healing_Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_Target Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing_TargetTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Bloodlust 1.0 0.0 0.0sec 0.0sec 10.13% 50.00% 0.0(0.0) 1.0

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_bloodlust
  • max_stacks:1
  • duration:40.00
  • cooldown:300.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bloodlust_1:10.13%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:2825
  • name:Bloodlust
  • tooltip:Haste increased by {$s1=30}%.
  • description:Increases Haste by {$s1=30}% for all party and raid members for {$d=40 seconds}. Allies receiving this effect will become Sated and unable to benefit from Bloodlust or Time Warp again for {$57724d=600 seconds}.
  • max_stacks:0
  • duration:40.00
  • cooldown:300.00
  • default_chance:0.00%
raid_movement 32.8 2.0 12.0sec 11.3sec 14.53% 14.53% 2.0(2.0) 0.0

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_raid_movement
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • raid_movement_1:14.53%

Trigger Attempt Success

  • trigger_pct:100.00%
Shield of Vengeance 2.8 0.0 180.0sec 180.0sec 10.12% 10.12% 0.0(0.0) 2.7

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_shield_of_vengeance
  • max_stacks:1
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
  • default_value:0.00

Stack Uptimes

  • shield_of_vengeance_1:10.12%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:184662
  • name:Shield of Vengeance
  • tooltip:Absorbs $w1 damage and deals damage when fully consumed.
  • description:Creates a barrier of holy light that absorbs ${$AP*10} damage for {$d=15 seconds}. When the barrier is consumed, all damage absorbed is dealt as Holy damage divided across all enemies within $184689A1 yds.
  • max_stacks:0
  • duration:15.00
  • cooldown:120.00
  • default_chance:101.00%
Constant Buffs
Health Decade (90 - 100)

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:100.00%

Trigger Attempt Success

  • trigger_pct:100.00%
bleeding

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:100.00%
Mortal Wounds

Buff details

  • buff initial source:Healing_Target
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Healing_Target
Resource RPS-Gain RPS-Loss
Health 16647.22 0.00
Combat End Resource Mean Min Max
Health 20000000.00 20000000.00 20000000.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Healing_Target Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Healing_Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
Priority Target DPS
Sample Data Healing_Target Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Healing_Target Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Healing_Target Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Healing_Target Damage Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS
Sample Data Healing_Target Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Healing_Target Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Healing_Target Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Healing_Target Healing Taken Per Second
Count 9999
Mean 16888.77
Minimum 13544.22
Maximum 21727.06
Spread ( max - min ) 8182.85
Range [ ( max - min ) / 2 * 100% ] 24.23%
Standard Deviation 2043.9880
5th Percentile 14036.27
95th Percentile 20471.75
( 95th Percentile - 5th Percentile ) 6435.48
Mean Distribution
Standard Deviation 20.4409
95.00% Confidence Intervall ( 16848.71 - 16928.84 )
Normalized 95.00% Confidence Intervall ( 99.76% - 100.24% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 562
0.1% Error 56267
0.1 Scale Factor Error with Delta=300 35664
0.05 Scale Factor Error with Delta=300 142659
0.01 Scale Factor Error with Delta=300 3566484
TMI
Sample Data Healing_Target Theck-Meloree Index
Count 9999
Mean 62309.93
Minimum 61080.06
Maximum 65824.25
Spread ( max - min ) 4744.19
Range [ ( max - min ) / 2 * 100% ] 3.81%
Standard Deviation 1342.2754
5th Percentile 61141.10
95th Percentile 65056.93
( 95th Percentile - 5th Percentile ) 3915.82
Mean Distribution
Standard Deviation 13.4234
95.00% Confidence Intervall ( 62283.62 - 62336.24 )
Normalized 95.00% Confidence Intervall ( 99.96% - 100.04% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 17
0.1% Error 1782
0.1 Scale Factor Error with Delta=300 15380
0.05 Scale Factor Error with Delta=300 61521
0.01 Scale Factor Error with Delta=300 1538037
ETMI
Sample Data Healing_TargetTheck-Meloree Index (Effective)
Count 9999
Mean 55159.98
Minimum 53117.55
Maximum 60320.39
Spread ( max - min ) 7202.84
Range [ ( max - min ) / 2 * 100% ] 6.53%
Standard Deviation 1405.8140
5th Percentile 53537.22
95th Percentile 57954.81
( 95th Percentile - 5th Percentile ) 4417.59
Mean Distribution
Standard Deviation 14.0588
95.00% Confidence Intervall ( 55132.42 - 55187.53 )
Normalized 95.00% Confidence Intervall ( 99.95% - 100.05% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 24
0.1% Error 2495
0.1 Scale Factor Error with Delta=300 16870
0.05 Scale Factor Error with Delta=300 67483
0.01 Scale Factor Error with Delta=300 1687094
MSD
Sample Data Healing_Target Max Spike Value
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Sample Sequence

Sample Sequence Table

time name target resources buffs
0:12.000 Waiting 385.000 sec 14019265.3/20000000: 70% health bloodlust, raid_movement, shield_of_vengeance

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 20000000 0
Crit 0.00% 5.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 1536 1536
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 0.00% 0
Tank-Block 0.00% 0.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

unknown="Healing_Target"
level=100
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown


# Gear Summary
# gear_ilvl=0.00

Simulation & Raid Information

Iterations: 10003
Threads: 4
Confidence: 95.00%
Fight Length: 307 - 492 ( 400.5 )

Performance:

Total Events Processed: 1022572122
Max Event Queue: 593
Sim Seconds: 4005873
CPU Seconds: 1144.6094
Physical Seconds: 300.0918
Speed Up: 3500

Settings:

World Lag: 100 ms ( stddev = 10 ms )
Queue Lag: 5 ms ( stddev = 1 ms )

Raw Ability Summary

Character Unit Ability Id Total DPS Imp/Min Hit Crit Count Impacts Crit% Avoid% G% B% Interval Combined Duration
Mortwraith Mortwraith annihilation 201427 8046043 20092 5.45 152641 333162 18.2 36.4 37.9% 0.0% 0.0% 0.0% 16.04sec 8046043 400.47sec
Mortwraith Mortwraith augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mortwraith Mortwraith auto_attack_mh 0 2809368 7015 17.23 20529 41066 115.0 115.0 38.0% 19.0% 0.0% 0.0% 3.36sec 4130038 400.47sec
Mortwraith Mortwraith auto_attack_oh 1 1404532 3507 17.23 10265 20535 115.0 115.0 37.9% 19.0% 0.0% 0.0% 3.36sec 2064796 400.47sec
Mortwraith Mortwraith blade_dance 188499 18630655 46522 62.06 32610 65190 18.0 414.2 38.0% 0.0% 0.0% 0.0% 15.80sec 27388827 400.47sec
Mortwraith Mortwraith blur 198589 0 0 0.00 0 0 0.2 0.0 0.0% 0.0% 0.0% 0.0% 184.14sec 0 400.47sec
Mortwraith Mortwraith chaos_blade_mh 211796 4195540 10477 3.19 142604 285124 21.3 21.3 38.1% 0.0% 0.0% 0.0% 16.77sec 4195540 400.47sec
Mortwraith Mortwraith chaos_blade_oh 211797 2092996 5226 3.19 71293 142592 21.3 21.3 37.8% 0.0% 0.0% 0.0% 16.77sec 2092996 400.47sec
Mortwraith Mortwraith chaos_blades 211048 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 122.39sec 0 400.47sec
Mortwraith Mortwraith chaos_strike 162794 24192337 60410 24.38 102720 223909 81.4 162.7 37.9% 0.0% 0.0% 0.0% 4.52sec 24192337 400.47sec
Mortwraith Mortwraith consume_magic 183752 0 0 0.00 0 0 12.6 0.0 0.0% 0.0% 0.0% 0.0% 32.66sec 0 400.47sec
Mortwraith Mortwraith death_sweep 210152 8790117 21950 18.42 51801 103628 5.4 123.0 38.0% 0.0% 0.0% 0.0% 55.98sec 12922305 400.47sec
Mortwraith Mortwraith demons_bite 162243 7143062 17837 14.18 54651 109339 94.7 94.7 38.0% 0.0% 0.0% 0.0% 4.19sec 10500977 400.47sec
Mortwraith Mortwraith eye_beam ticks -198013 27260203 68151 16.68 0 49277 11.8 111.2 100.0% 0.0% 0.0% 0.0% 32.71sec 27260203 400.47sec
Mortwraith Mortwraith anguish 202446 11599886 28966 8.64 145817 291753 0.0 57.7 37.9% 0.0% 0.0% 0.0% 0.00sec 11599886 400.47sec
Mortwraith Mortwraith fel_rush 195072 22729808 56758 18.26 135189 270390 34.9 121.9 38.0% 0.0% 0.0% 0.0% 11.65sec 22729808 400.47sec
Mortwraith Mortwraith flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mortwraith Mortwraith food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mortwraith Mortwraith fury_of_the_illidari ticks -201467 19773151 49433 7.40 31941 63890 7.1 49.3 38.0% 0.0% 0.0% 0.0% 60.60sec 19773151 400.47sec
Mortwraith Mortwraith rage_of_the_illidari 217070 11855438 29604 4.79 370644 0 7.0 32.0 0.0% 0.0% 0.0% 0.0% 60.60sec 11855438 400.47sec
Mortwraith Mortwraith mark_of_the_hidden_satyr 191259 1884823 4707 3.32 61666 123428 22.2 22.2 37.9% 0.0% 0.0% 0.0% 18.07sec 1884823 400.47sec
Mortwraith Mortwraith metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mortwraith Mortwraith metamorphosis_impact 200166 694055 1733 1.04 72582 145150 2.0 6.9 38.1% 0.0% 0.0% 0.0% 0.00sec 694055 400.47sec
Mortwraith Mortwraith potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mortwraith Mortwraith potion_of_the_old_war 188028 5556720 13876 3.70 162923 326090 24.7 24.7 37.9% 0.0% 0.0% 0.0% 11.76sec 8168905 400.47sec
Mortwraith Mortwraith throw_glaive 185123 17048874 42572 16.08 115230 230406 47.9 107.3 37.9% 0.0% 0.0% 0.0% 8.43sec 25063459 400.47sec
Mortwraith Mortwraith bloodlet ticks -207690 21014787 52537 52.73 59780 0 0.0 351.5 0.0% 0.0% 0.0% 0.0% 0.00sec 21014787 400.47sec
Mortwraith Mortwraith vengeful_retreat 198793 2040298 5095 12.50 17725 35464 25.4 83.4 38.0% 0.0% 0.0% 0.0% 15.91sec 2999431 400.47sec
Táunks Táunks annihilation 201427 7284064 18189 5.78 121032 278438 19.3 38.5 43.2% 0.0% 0.0% 0.0% 15.76sec 7284064 400.47sec
Táunks Táunks augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Táunks Táunks auto_attack_mh 0 3450043 8615 21.25 19585 39166 141.8 141.8 43.2% 19.0% 0.0% 0.0% 2.82sec 5071890 400.47sec
Táunks Táunks auto_attack_oh 1 1726193 4310 21.25 9793 19582 141.8 141.8 43.2% 19.0% 0.0% 0.0% 2.82sec 2537667 400.47sec
Táunks Táunks blade_dance 188499 19909957 49717 66.60 31299 62545 19.4 444.5 43.2% 0.0% 0.0% 0.0% 14.76sec 29269522 400.47sec
Táunks Táunks blur 198589 0 0 0.00 0 0 3.5 0.0 0.0% 0.0% 0.0% 0.0% 106.30sec 0 400.47sec
Táunks Táunks chaos_strike 162794 23948379 59801 24.53 93631 215369 81.9 163.7 43.2% 0.0% 0.0% 0.0% 4.45sec 23948379 400.47sec
Táunks Táunks consume_magic 183752 0 0 0.00 0 0 13.3 0.0 0.0% 0.0% 0.0% 0.0% 30.81sec 0 400.47sec
Táunks Táunks death_sweep 210152 7249088 18102 16.46 46065 92185 4.9 109.9 43.2% 0.0% 0.0% 0.0% 64.66sec 10656846 400.47sec
Táunks Táunks demon_blades 203796 6895856 17220 25.44 28359 56720 169.8 169.8 43.2% 0.0% 0.0% 0.0% 5.87sec 6895856 400.47sec
Táunks Táunks eye_beam ticks -198013 15077051 37693 10.76 0 46912 7.4 71.7 100.0% 0.0% 0.0% 0.0% 54.10sec 15077051 400.47sec
Táunks Táunks anguish 202446 6232591 15563 4.73 138018 276026 0.0 31.5 43.2% 0.0% 0.0% 0.0% 0.00sec 6232591 400.47sec
Táunks Táunks fel_barrage 211053 17224524 43011 21.98 82058 164094 9.4 146.7 43.1% 0.0% 0.0% 0.0% 44.55sec 17224524 400.47sec
Táunks Táunks fel_rush 195072 28761620 71820 24.20 124342 248687 42.5 161.5 43.2% 0.0% 0.0% 0.0% 9.49sec 28761620 400.47sec
Táunks Táunks flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Táunks Táunks food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Táunks Táunks fury_of_the_illidari ticks -201467 17863730 44659 7.41 27861 55682 7.1 49.4 43.2% 0.0% 0.0% 0.0% 60.39sec 17863730 400.47sec
Táunks Táunks inner_demons 202388 6286906 15699 2.78 236649 473412 7.0 18.5 43.3% 0.0% 0.0% 0.0% 51.78sec 6286906 400.47sec
Táunks Táunks metamorphosis 191427 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 243.60sec 0 400.47sec
Táunks Táunks metamorphosis_impact 200166 649307 1621 0.97 70465 140756 2.0 6.4 43.1% 0.0% 0.0% 0.0% 243.60sec 649307 400.47sec
Táunks Táunks potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Táunks Táunks potion_of_the_old_war 188028 4460717 11139 3.50 133266 266522 23.4 23.4 43.1% 0.0% 0.0% 0.0% 12.58sec 6557676 400.47sec
Táunks Táunks throw_glaive 185123 17468595 43621 17.18 106333 212641 50.3 114.7 43.3% 0.0% 0.0% 0.0% 7.99sec 25680489 400.47sec
Táunks Táunks bloodlet ticks -207690 21424211 53561 54.06 59445 0 0.0 360.4 0.0% 0.0% 0.0% 0.0% 0.00sec 21424211 400.47sec
Táunks Táunks vengeful_retreat 198793 1329214 3319 8.37 16629 33258 15.9 55.8 43.1% 0.0% 0.0% 0.0% 25.82sec 1954071 400.47sec
Illistan Illistan augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Illistan Illistan auto_attack_mh 0 3910815 9766 22.13 21364 42725 147.7 147.7 42.9% 18.9% 0.0% 6.1% 2.72sec 5881623 400.47sec
Illistan Illistan auto_attack_oh 1 1833719 4579 20.75 10683 21365 138.5 138.5 42.9% 19.0% 0.0% 6.0% 2.90sec 2757530 400.47sec
Illistan Illistan consume_soul_lesser 203794 0 0 0.00 0 0 64.3 0.0 0.0% 0.0% 0.0% 0.0% 6.16sec 0 400.47sec
Illistan Illistan demon_spikes 203720 0 0 0.00 0 0 36.1 0.0 0.0% 0.0% 0.0% 0.0% 11.18sec 0 400.47sec
Illistan Illistan empower_wards 218256 0 0 0.00 0 0 11.3 0.0 0.0% 0.0% 0.0% 0.0% 36.89sec 0 400.47sec
Illistan Illistan felblade 232893 4936193 12326 6.03 85820 171659 40.2 40.2 43.0% 0.0% 0.0% 7.5% 9.98sec 4936193 400.47sec
Illistan Illistan fiery_brand 204021 2254881 5631 1.06 223227 446453 7.1 7.1 42.9% 0.0% 0.0% 0.0% 60.61sec 2254881 400.47sec
Illistan Illistan flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Illistan Illistan food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Illistan Illistan immolation_aura 178740 29760006 74313 104.41 29883 59790 29.1 696.9 42.9% 0.0% 0.0% 0.0% 13.93sec 29760006 400.47sec
Illistan Illistan infernal_strike 189110 10333779 25804 10.74 100871 201747 21.3 71.7 43.0% 0.0% 0.0% 0.0% 20.11sec 10333779 400.47sec
Illistan Illistan potion 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Illistan Illistan shear 203782 13183480 32920 23.42 59028 118043 156.3 156.3 42.9% 0.0% 0.0% 7.5% 2.54sec 19826325 400.47sec
Illistan Illistan sigil_of_flame 204596 2627839 6562 5.23 52732 105440 13.3 34.9 42.8% 0.0% 0.0% 0.0% 31.01sec 4472008 400.47sec
Illistan Illistan sigil_of_flame ticks -204596 1844169 4610 10.35 18706 37412 13.3 69.0 42.9% 0.0% 0.0% 0.0% 31.01sec 4472008 400.47sec
Illistan Illistan soul_carver 207407 2212137 5524 2.12 109681 219599 7.1 14.1 42.7% 0.0% 0.0% 7.6% 60.65sec 3754642 400.47sec
Illistan Illistan soul_carver ticks -207407 1542505 3856 3.17 51157 102315 7.1 21.1 42.9% 0.0% 0.0% 0.0% 60.65sec 3754642 400.47sec
Illistan Illistan soul_cleave 228477 7467694 18647 6.64 117969 235879 44.3 44.3 42.8% 0.0% 0.0% 7.5% 8.99sec 11231500 400.47sec
Illistan Illistan soul_cleave_heal 228477 0 0 0.00 0 0 44.3 0.0 0.0% 0.0% 0.0% 0.0% 8.99sec 0 400.47sec
Madarii Madarii augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Madarii Madarii deadly_grace 188091 3965267 9902 4.04 117370 239476 27.1 27.0 24.2% 0.0% 0.0% 0.0% 8.38sec 3965267 400.47sec
Madarii Madarii flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Madarii Madarii food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Madarii Madarii full_moon 202771 7545448 18842 2.47 365775 740973 7.8 16.5 24.3% 0.0% 0.0% 0.0% 54.26sec 5999207 400.47sec
Madarii Madarii half_moon 202768 3508381 8761 1.21 348108 709906 8.1 8.1 24.2% 0.0% 0.0% 0.0% 51.56sec 3508381 400.47sec
Madarii Madarii incarnation 102560 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 185.08sec 0 400.47sec
Madarii Madarii lunar_strike 194153 28642166 71522 43.79 69666 142052 63.5 292.3 39.1% 0.0% 0.0% 0.0% 6.10sec 28642166 400.47sec
Madarii Madarii moonfire 8921 1199216 2995 2.82 51017 104006 18.8 18.8 24.1% 0.0% 0.0% 0.0% 22.01sec 9560730 400.47sec
Madarii Madarii moonfire ticks -8921 8361515 20904 37.86 26476 54023 18.8 252.4 24.1% 0.0% 0.0% 0.0% 22.01sec 9560730 400.47sec
Madarii Madarii moonkin_form 24858 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Madarii Madarii new_moon 202767 1828858 4567 1.26 174113 355144 7.4 8.4 24.2% 0.0% 0.0% 0.0% 51.47sec 1828858 400.47sec
Madarii Madarii potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Madarii Madarii shooting_stars 202497 1183507 2955 8.16 17378 35460 77.8 54.4 24.1% 0.0% 0.0% 0.0% 5.37sec 1183507 400.47sec
Madarii Madarii solar_wrath 190984 10160734 25372 11.68 104194 212341 78.6 77.9 24.2% 0.0% 0.0% 0.0% 5.04sec 10160734 400.47sec
Madarii Madarii starfall ticks -191034 22041735 55104 0.00 25487 51986 15.2 0.0 24.1% 0.0% 0.0% 0.0% 19.56sec 22041735 400.47sec
Madarii Madarii starsurge 78674 7451363 18607 2.91 255019 520515 19.5 19.4 48.3% 0.0% 0.0% 0.0% 20.71sec 7451363 400.47sec
Madarii Madarii goldrinns_fang 203001 1335590 3335 0.96 166293 339368 6.5 6.4 24.0% 0.0% 0.0% 0.0% 57.81sec 1335590 400.47sec
Madarii Madarii sunfire 93402 3878226 9684 9.81 47379 96629 14.4 65.5 24.1% 0.0% 0.0% 0.0% 24.32sec 19769271 400.47sec
Madarii Madarii sunfire ticks -93402 15891045 39728 78.84 24173 49324 14.4 525.6 24.1% 0.0% 0.0% 0.0% 24.32sec 19769271 400.47sec
Madarii Madarii tormenting_cyclone 221857 5489232 13707 50.92 12914 26353 14.3 339.8 24.1% 0.0% 0.0% 0.0% 27.14sec 5489232 400.47sec
Oinkie Oinkie ashamanes_rip ticks -210705 3534527 8836 6.69 55418 113071 5.7 44.6 41.4% 0.0% 0.0% 0.0% 58.66sec 3534527 400.47sec
Oinkie Oinkie augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Oinkie Oinkie berserk 106951 0 0 0.00 0 0 2.7 0.0 0.0% 0.0% 0.0% 0.0% 182.06sec 0 400.47sec
Oinkie Oinkie cat_form 768 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Oinkie Oinkie cat_melee 0 11827386 29534 63.30 19573 39935 422.5 422.5 41.3% 0.0% 0.0% 0.0% 0.95sec 16923204 400.47sec
Oinkie Oinkie dash 1850 0 0 0.00 0 0 2.4 0.0 0.0% 0.0% 0.0% 0.0% 188.51sec 0 400.47sec
Oinkie Oinkie ferocious_bite 22568 1765676 4409 1.13 153507 348125 7.5 7.5 41.4% 0.0% 0.0% 0.0% 56.71sec 2492619 400.47sec
Oinkie Oinkie flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Oinkie Oinkie food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Oinkie Oinkie lunar_inspiration 155625 993127 2480 2.63 39502 80578 17.6 17.6 41.5% 0.0% 0.0% 0.0% 23.49sec 7157775 400.47sec
Oinkie Oinkie lunar_inspiration ticks -155625 6164648 15412 22.80 28366 57831 17.6 152.0 41.4% 0.0% 0.0% 0.0% 23.49sec 7157775 400.47sec
Oinkie Oinkie potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Oinkie Oinkie potion_of_the_old_war 188028 5849426 14607 3.55 172698 352173 23.7 23.7 41.3% 0.0% 0.0% 0.0% 14.35sec 8599210 400.47sec
Oinkie Oinkie rake 1822 1753004 4377 2.85 64340 131360 19.1 19.1 41.3% 0.0% 0.0% 0.0% 22.46sec 10363869 400.47sec
Oinkie Oinkie rake ticks -1822 8610865 21527 16.63 54350 110723 19.1 110.9 41.3% 0.0% 0.0% 0.0% 22.46sec 10363869 400.47sec
Oinkie Oinkie rip ticks -1079 16370626 40927 32.29 53191 108519 14.7 215.3 41.3% 0.0% 0.0% 0.0% 23.49sec 16370626 400.47sec
Oinkie Oinkie savage_roar 52610 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 28.70sec 0 400.47sec
Oinkie Oinkie shred 5221 8167441 20395 7.57 101941 208175 50.5 50.5 56.3% 0.0% 0.0% 0.0% 7.96sec 11623364 400.47sec
Oinkie Oinkie skull_bash 106839 0 0 0.00 0 0 13.5 0.0 0.0% 0.0% 0.0% 0.0% 30.35sec 0 400.47sec
Oinkie Oinkie swipe_cat 106785 29719965 74213 54.79 56814 115909 60.9 365.7 41.4% 0.0% 0.0% 0.0% 4.79sec 43432857 400.47sec
Oinkie Oinkie thrash_cat 106830 4101997 10243 20.24 21222 43291 22.5 135.1 41.4% 0.0% 0.0% 0.0% 13.18sec 15140202 400.47sec
Oinkie Oinkie thrash_cat ticks -106830 11038205 27596 82.68 13996 28562 22.5 551.2 41.4% 0.0% 0.0% 0.0% 13.18sec 15140202 400.47sec
Oinkie Oinkie shadow_thrash ticks -210686 3023549 7559 2.54 21908 44674 5.6 16.9 41.4% 0.0% 0.0% 0.0% 44.42sec 3023549 400.47sec
Oinkie Oinkie tigers_fury 5217 0 0 0.00 0 0 13.6 0.0 0.0% 0.0% 0.0% 0.0% 30.33sec 0 400.47sec
Oinkie Oinkie wild_charge 102401 0 0 0.00 0 0 16.1 0.0 0.0% 0.0% 0.0% 0.0% 24.26sec 0 400.47sec
Rothlandra Rothlandra aimed_shot 19434 43171106 107802 17.39 243644 591130 116.2 116.1 36.9% 0.0% 0.0% 0.0% 3.43sec 63465614 400.47sec
Rothlandra Rothlandra legacy_of_the_windrunners 19434 7455333 18617 15.58 46991 114423 0.0 104.0 36.6% 0.0% 0.0% 0.0% 0.00sec 10960045 400.47sec
Rothlandra Rothlandra arcane_torrent 80483 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.04sec 0 400.47sec
Rothlandra Rothlandra augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Rothlandra Rothlandra auto_shot 0 6036556 15074 24.51 27258 59636 163.6 163.6 29.8% 0.0% 0.0% 0.0% 2.45sec 8874309 400.47sec
Rothlandra Rothlandra barrage ticks -120360 32555577 81389 44.16 23680 51147 19.3 294.4 28.1% 0.0% 0.0% 0.0% 21.28sec 47859782 400.47sec
Rothlandra Rothlandra deadly_grace 188091 3451005 8617 4.85 79979 187991 32.5 32.4 24.6% 0.0% 0.0% 0.0% 3.39sec 3451005 400.47sec
Rothlandra Rothlandra flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Rothlandra Rothlandra marked_shot 185901 54319025 135639 17.92 317849 683293 36.9 119.6 37.3% 0.0% 0.0% 0.0% 10.90sec 79854112 400.47sec
Rothlandra Rothlandra pepper_breath ticks -225622 1674304 4186 14.98 16973 0 20.1 99.9 0.0% 0.0% 0.0% 0.0% 19.82sec 1674304 400.47sec
Rothlandra Rothlandra potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Rothlandra Rothlandra sidewinders 214579 21770325 54362 23.19 108139 230828 45.1 154.8 26.5% 0.0% 0.0% 0.0% 8.90sec 21770325 400.47sec
Rothlandra Rothlandra trueshot 193526 0 0 0.00 0 0 3.4 0.0 0.0% 0.0% 0.0% 0.0% 142.28sec 0 400.47sec
Rothlandra Rothlandra windburst 204147 8315810 20765 2.52 371529 788382 15.8 16.8 29.6% 0.0% 0.0% 0.0% 24.49sec 12225028 400.47sec
Sarkul Sarkul aimed_shot 19434 39660811 99036 15.10 271631 637994 100.9 100.8 33.3% 0.0% 0.0% 0.0% 3.95sec 58305149 400.47sec
Sarkul Sarkul legacy_of_the_windrunners 19434 6773468 16914 13.51 51777 122675 0.0 90.2 32.9% 0.0% 0.0% 0.0% 0.00sec 9957640 400.47sec
Sarkul Sarkul augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Sarkul Sarkul auto_shot 0 4996390 12476 22.43 25241 54717 149.7 149.7 27.6% 0.0% 0.0% 0.0% 2.68sec 7345167 400.47sec
Sarkul Sarkul barrage ticks -120360 35502229 88756 46.45 25353 53608 19.4 309.7 25.6% 0.0% 0.0% 0.0% 21.17sec 52191639 400.47sec
Sarkul Sarkul blood_fury 20572 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.55sec 0 400.47sec
Sarkul Sarkul deadly_grace 188091 3224659 8052 4.54 79983 190018 30.6 30.3 24.0% 0.0% 0.0% 0.0% 6.34sec 3224659 400.47sec
Sarkul Sarkul flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Sarkul Sarkul mark_of_the_hidden_satyr 191259 1532196 3826 3.48 50006 108083 23.2 23.2 27.6% 0.0% 0.0% 0.0% 17.28sec 1532196 400.47sec
Sarkul Sarkul marked_shot 185901 55427142 138406 17.60 340974 714324 36.4 117.5 35.0% 0.0% 0.0% 0.0% 11.02sec 81483149 400.47sec
Sarkul Sarkul call_of_the_hunter 191070 4377772 10932 8.16 62344 132335 14.8 54.5 25.7% 0.0% 0.0% 0.0% 50.82sec 6435740 400.47sec
Sarkul Sarkul pepper_breath ticks -225622 1541276 3853 13.81 16976 0 18.5 92.1 0.0% 0.0% 0.0% 0.0% 21.47sec 1541276 400.47sec
Sarkul Sarkul potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Sarkul Sarkul rancid_maw 215405 4667374 11655 2.76 191428 415259 18.6 18.4 27.6% 0.0% 0.0% 0.0% 21.39sec 4667374 400.47sec
Sarkul Sarkul sidewinders 214579 18687029 46663 21.33 103616 216538 41.7 142.4 24.5% 0.0% 0.0% 0.0% 9.63sec 18687029 400.47sec
Sarkul Sarkul trueshot 193526 0 0 0.00 0 0 2.8 0.0 0.0% 0.0% 0.0% 0.0% 196.66sec 0 400.47sec
Sarkul Sarkul windburst 204147 8510661 21252 2.49 396327 825840 15.7 16.6 26.7% 0.0% 0.0% 0.0% 24.73sec 12511478 400.47sec
Mellarene Mellarene arcane_torrent 28730 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 122.45sec 0 400.47sec
Mellarene Mellarene augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mellarene Mellarene combustion 190319 0 0 0.00 0 0 5.4 0.0 0.0% 0.0% 0.0% 0.0% 82.13sec 0 400.47sec
Mellarene Mellarene conflagration_dot ticks -226757 310407 776 26.53 1755 0 92.9 176.9 0.0% 0.0% 0.0% 0.0% 4.11sec 310407 400.47sec
Mellarene Mellarene conflagration_explosion 205023 7985562 19941 42.39 14288 34619 63.8 282.9 68.5% 0.0% 0.0% 0.0% 6.11sec 7985562 400.47sec
Mellarene Mellarene counterspell 2139 0 0 0.00 0 0 9.7 0.0 0.0% 0.0% 0.0% 0.0% 42.87sec 0 400.47sec
Mellarene Mellarene deadly_grace 188091 4329559 10811 3.13 85962 235513 20.9 20.9 81.2% 0.0% 0.0% 0.0% 5.37sec 4329559 400.47sec
Mellarene Mellarene fire_blast 108853 6265083 15644 6.81 0 137746 45.5 45.5 100.0% 0.0% 0.0% 0.0% 8.87sec 6265083 400.47sec
Mellarene Mellarene fireball 133 11736390 29307 13.93 65128 147648 93.1 92.9 74.1% 0.0% 0.0% 0.0% 4.11sec 11736390 400.47sec
Mellarene Mellarene flame_on 205029 0 0 0.00 0 0 5.8 0.0 0.0% 0.0% 0.0% 0.0% 78.95sec 0 400.47sec
Mellarene Mellarene flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mellarene Mellarene food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mellarene Mellarene ignite ticks -12846 21678131 54195 95.56 34028 0 301.5 637.0 0.0% 0.0% 0.0% 0.0% 1.36sec 21678131 400.47sec
Mellarene Mellarene living_bomb ticks -44457 4854389 12136 44.69 8647 20202 87.3 297.9 66.2% 0.0% 0.0% 0.0% 9.25sec 4854389 400.47sec
Mellarene Mellarene living_bomb_explosion 44461 24798634 61924 70.84 27701 65057 87.3 472.8 66.2% 0.0% 0.0% 0.0% 9.24sec 24798634 400.47sec
Mellarene Mellarene mark_of_the_hidden_satyr 191259 3774803 9426 3.20 87215 216151 21.3 21.3 69.6% 0.0% 0.0% 0.0% 18.61sec 3774803 400.47sec
Mellarene Mellarene phoenix_reborn 215773 1436619 3587 6.03 17695 43678 40.2 40.2 69.4% 0.0% 0.0% 0.0% 9.72sec 1436619 400.47sec
Mellarene Mellarene phoenixs_flames 194466 6130200 15308 2.88 0 319380 19.2 19.2 100.0% 0.0% 0.0% 0.0% 21.41sec 6130200 400.47sec
Mellarene Mellarene phoenixs_flames_splash 224637 4021578 10042 6.12 0 98467 19.2 40.8 100.0% 0.0% 0.0% 0.0% 21.45sec 4021578 400.47sec
Mellarene Mellarene potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Mellarene Mellarene pyroblast 11366 35569971 88821 15.43 147009 395381 102.2 103.0 79.8% 0.0% 0.0% 0.0% 3.92sec 35569971 400.47sec
Mellarene Mellarene rune_of_power 116011 0 0 0.00 0 0 9.1 0.0 0.0% 0.0% 0.0% 0.0% 47.83sec 0 400.47sec
Mellarene Mellarene scorch 2948 5656 14 0.02 0 52562 0.1 0.1 100.0% 0.0% 0.0% 0.0% 82.79sec 5656 400.47sec
Mellarene Mellarene tormenting_cyclone 221857 7242846 18086 45.96 12279 28842 12.7 306.8 68.4% 0.0% 0.0% 0.0% 30.29sec 7242846 400.47sec
Mellarene Mellarene volatile_ichor 222187 12473625 31148 8.55 114738 267901 16.9 57.0 67.8% 0.0% 0.0% 0.0% 23.22sec 12473625 400.47sec
Morepyro Morepyro arcane_torrent 28730 0 0 0.00 0 0 3.9 0.0 0.0% 0.0% 0.0% 0.0% 114.94sec 0 400.47sec
Morepyro Morepyro augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Morepyro Morepyro combustion 190319 0 0 0.00 0 0 5.3 0.0 0.0% 0.0% 0.0% 0.0% 84.34sec 0 400.47sec
Morepyro Morepyro conflagration_dot ticks -226757 302160 755 27.43 1652 0 106.4 182.9 0.0% 0.0% 0.0% 0.0% 3.61sec 302160 400.47sec
Morepyro Morepyro conflagration_explosion 205023 6010796 15009 35.67 13500 32225 56.4 238.1 62.7% 0.0% 0.0% 0.0% 6.90sec 6010796 400.47sec
Morepyro Morepyro counterspell 2139 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 41.36sec 0 400.47sec
Morepyro Morepyro deadly_grace 188091 4151491 10367 3.16 83653 234773 21.1 21.1 75.0% 0.0% 0.0% 0.0% 5.43sec 4151491 400.47sec
Morepyro Morepyro fire_blast 108853 5618170 14029 6.84 0 123049 45.7 45.7 100.0% 0.0% 0.0% 0.0% 8.83sec 5618170 400.47sec
Morepyro Morepyro fireball 133 11415565 28506 15.94 61638 132191 106.6 106.4 64.7% 0.0% 0.0% 0.0% 3.62sec 11415565 400.47sec
Morepyro Morepyro flame_on 205029 0 0 0.00 0 0 5.7 0.0 0.0% 0.0% 0.0% 0.0% 80.96sec 0 400.47sec
Morepyro Morepyro flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Morepyro Morepyro food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Morepyro Morepyro ignite ticks -12846 19668727 49172 84.43 34946 0 277.2 562.8 0.0% 0.0% 0.0% 0.0% 1.47sec 19668727 400.47sec
Morepyro Morepyro living_bomb ticks -44457 4359582 10899 46.32 8070 18452 96.6 308.8 58.3% 0.0% 0.0% 0.0% 8.63sec 4359582 400.47sec
Morepyro Morepyro living_bomb_explosion 44461 23694708 59168 77.56 25872 59937 96.6 517.7 58.4% 0.0% 0.0% 0.0% 8.50sec 23694708 400.47sec
Morepyro Morepyro phoenixs_flames 194466 3415617 8529 1.69 0 302735 11.3 11.3 100.0% 0.0% 0.0% 0.0% 37.39sec 3415617 400.47sec
Morepyro Morepyro phoenixs_flames_splash 224637 2082333 5200 3.34 0 93466 11.3 22.3 100.0% 0.0% 0.0% 0.0% 37.41sec 2082333 400.47sec
Morepyro Morepyro potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Morepyro Morepyro pyroblast 11366 27305304 68184 13.50 137293 363300 89.3 90.1 73.3% 0.0% 0.0% 0.0% 4.49sec 27305304 400.47sec
Morepyro Morepyro rune_of_power 116011 0 0 0.00 0 0 8.7 0.0 0.0% 0.0% 0.0% 0.0% 50.26sec 0 400.47sec
Morepyro Morepyro scorch 2948 69457 173 0.23 0 45743 1.5 1.5 100.0% 0.0% 0.0% 0.0% 129.95sec 69457 400.47sec
Zipi Zipi augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Zipi Zipi blade_of_justice 184575 14522894 36265 7.70 183869 566122 51.4 51.4 25.8% 0.0% 0.0% 0.0% 7.81sec 21350030 400.47sec
Zipi Zipi blessing_of_might_proc 205729 12680305 31664 40.38 47047 0 365.2 269.5 0.0% 0.0% 0.0% 0.0% 2.00sec 12680305 400.47sec
Zipi Zipi crusade 231895 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 125.97sec 0 400.47sec
Zipi Zipi divine_storm 53385 41380518 103331 37.18 131465 269457 41.4 248.1 25.6% 0.0% 0.0% 0.0% 7.08sec 41380518 400.47sec
Zipi Zipi execution_sentence ticks -213757 10136074 25340 2.50 478926 975689 17.0 16.7 26.0% 0.0% 0.0% 0.0% 24.47sec 10136074 400.47sec
Zipi Zipi flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Zipi Zipi food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Zipi Zipi greater_blessing_of_might 203528 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Zipi Zipi judgment 20271 10927021 27286 6.71 192103 392245 44.8 44.8 25.9% 0.0% 0.0% 0.0% 8.95sec 10927021 400.47sec
Zipi Zipi judgment_aoe 228288 5348220 13355 3.45 182975 374735 44.8 23.0 25.8% 0.0% 0.0% 0.0% 8.95sec 5348220 400.47sec
Zipi Zipi mark_of_the_hidden_satyr 191259 3076884 7683 4.12 88319 180456 27.5 27.5 25.7% 0.0% 0.0% 0.0% 14.66sec 3076884 400.47sec
Zipi Zipi melee 0 4747571 11855 17.07 32848 67128 113.9 113.9 25.8% 0.0% 0.0% 0.0% 3.51sec 6979379 400.47sec
Zipi Zipi potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Zipi Zipi potion_of_the_old_war 188028 5896611 14724 4.30 162051 332348 28.7 28.7 25.4% 0.0% 0.0% 0.0% 5.45sec 8668577 400.47sec
Zipi Zipi rebuke 96231 0 0 0.00 0 0 13.2 0.0 0.0% 0.0% 0.0% 0.0% 30.90sec 0 400.47sec
Zipi Zipi shield_of_vengeance 184662 0 0 0.74 0 0 4.9 4.9 24.8% 0.0% 0.0% 0.0% 90.00sec 3489929 400.47sec
Zipi Zipi shield_of_vengeance_proc 184689 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 89.66sec 0 400.47sec
Zipi Zipi templars_verdict 85256 12794250 31948 5.31 284287 579233 35.4 35.4 26.1% 0.0% 0.0% 0.0% 11.38sec 12794250 400.47sec
Zipi Zipi wake_of_ashes 205273 10763262 26877 6.94 183735 374948 13.1 46.3 25.5% 0.0% 0.0% 0.0% 31.91sec 17101074 400.47sec
Zipi Zipi wake_of_ashes ticks -205273 6337812 15845 23.66 31709 64635 13.1 157.7 25.7% 0.0% 0.0% 0.0% 31.91sec 17101074 400.47sec
Zipi Zipi zeal 217020 30353026 75794 43.57 71615 146546 119.6 290.8 43.7% 0.0% 0.0% 0.0% 3.34sec 44621823 400.47sec
Faelik Faelik augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Faelik Faelik deadly_grace 188091 3788667 9461 4.86 96654 193415 32.5 32.4 20.8% 0.0% 0.0% 0.0% 12.65sec 3788667 400.47sec
Faelik Faelik flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Faelik Faelik food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Faelik Faelik mind_blast 8092 12826571 32029 9.35 170067 339895 61.4 62.4 20.8% 0.0% 0.0% 0.0% 6.45sec 12826571 400.47sec
Faelik Faelik mind_flay ticks -15407 6672131 16680 24.63 33642 67263 58.8 164.2 20.8% 0.0% 0.0% 0.0% 6.85sec 6672131 400.47sec
Faelik Faelik mind_sear ticks -48045 16770689 41927 13.22 27761 55512 35.1 88.1 20.8% 0.0% 0.0% 0.0% 8.08sec 16770689 400.47sec
Faelik Faelik plague_swarm ticks -221812 5347943 13370 16.28 40773 81568 27.3 108.6 20.8% 0.0% 0.0% 0.0% 14.45sec 5347943 400.47sec
Faelik Faelik potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Faelik Faelik power_infusion 10060 0 0 0.00 0 0 3.6 0.0 0.0% 0.0% 0.0% 0.0% 120.92sec 0 400.47sec
Faelik Faelik shadow_word_death 32379 1780742 4447 1.21 182876 365948 8.1 8.1 20.9% 0.0% 0.0% 0.0% 9.95sec 1780742 400.47sec
Faelik Faelik shadow_word_pain 589 2508411 6264 7.80 39866 79767 52.1 52.1 20.8% 0.0% 0.0% 0.0% 7.51sec 25128022 400.47sec
Faelik Faelik shadow_word_pain ticks -589 22619611 56549 57.30 48994 98017 52.1 382.0 20.8% 0.0% 0.0% 0.0% 7.51sec 25128022 400.47sec
Faelik Faelik sphere_of_insanity 194182 5487526 13703 63.30 12988 0 322.2 422.5 0.0% 0.0% 0.0% 0.0% 1.20sec 0 400.47sec
Faelik Faelik shadowfiend 34433 0 0 0.00 0 0 2.3 0.0 0.0% 0.0% 0.0% 0.0% 198.93sec 0 400.47sec
Faelik Faelik shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Faelik Faelik shadowy_apparitions 78203 5573663 13918 24.17 28612 57220 162.5 161.3 20.8% 0.0% 0.0% 0.0% 2.43sec 5573663 400.47sec
Faelik Faelik touch_of_the_grave 127802 1311185 3274 3.80 51631 0 25.4 25.4 0.0% 0.0% 0.0% 0.0% 16.02sec 1311185 400.47sec
Faelik Faelik vampiric_touch ticks -34914 53978604 134947 79.50 84266 168598 41.1 530.0 20.9% 0.0% 0.0% 0.0% 7.40sec 53978604 400.47sec
Faelik Faelik void_bolt 205448 22735863 56773 15.57 181067 362135 104.2 103.9 20.9% 0.0% 0.0% 0.0% 3.69sec 22735863 400.47sec
Faelik Faelik void_eruption 228360 3636838 9081 7.49 60193 120379 10.4 50.0 20.9% 0.0% 0.0% 0.0% 39.10sec 3636838 400.47sec
Faelik Faelik void_torrent ticks -205065 5715674 14289 6.07 116964 234210 6.8 40.4 20.8% 0.0% 0.0% 0.0% 61.29sec 5715674 400.47sec
Faelik Faelik_shadowfiend melee 0 2956379 107299 77.16 69069 138133 35.4 35.4 20.8% 0.0% 0.0% 0.0% 8.03sec 2956379 27.55sec
Faelik Faelik_shadowfiend shadowcrawl 63619 0 0 0.00 0 0 4.6 0.0 0.0% 0.0% 0.0% 0.0% 74.83sec 0 27.55sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 2310561 5776 8.73 32850 65701 9.2 58.2 20.8% 0.0% 0.0% 0.0% 41.48sec 2310561 75.38sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 473489 1184 1.79 32850 65701 2.5 12.0 20.6% 0.0% 0.0% 0.0% 66.11sec 473489 16.52sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 299268 748 1.13 32850 65701 1.5 7.5 21.4% 0.0% 0.0% 0.0% 20.66sec 299268 10.14sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 286178 715 1.11 32850 65701 1.3 7.4 17.7% 0.0% 0.0% 0.0% 5.32sec 286178 9.61sec
Faelik Faelik_void_tendril mind_flay_void_tendril ticks -193473 197103 493 0.75 32850 65701 2.0 5.0 20.0% 0.0% 0.0% 0.0% 0.00sec 197103 10.00sec
Raji Raji augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Raji Raji berserking 26297 0 0 0.00 0 0 2.6 0.0 0.0% 0.0% 0.0% 0.0% 185.77sec 0 400.47sec
Raji Raji deadly_grace 188091 3656875 9132 4.20 97398 194838 28.1 28.0 33.9% 0.0% 0.0% 0.0% 14.75sec 3656875 400.47sec
Raji Raji flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Raji Raji food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Raji Raji mind_blast 8092 9360187 23373 7.27 144009 288081 47.6 48.6 33.9% 0.0% 0.0% 0.0% 8.35sec 9360187 400.47sec
Raji Raji mind_flay ticks -15407 5292768 13232 18.50 32066 64139 47.1 123.3 33.8% 0.0% 0.0% 0.0% 8.54sec 5292768 400.47sec
Raji Raji mind_sear ticks -48045 15292881 38232 10.51 28648 57299 27.4 70.0 33.9% 0.0% 0.0% 0.0% 10.50sec 15292881 400.47sec
Raji Raji mindbender 200174 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.46sec 0 400.47sec
Raji Raji potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Raji Raji shadow_word_death 32379 3437572 8584 2.13 180785 361401 14.2 14.2 33.8% 0.0% 0.0% 0.0% 10.16sec 3437572 400.47sec
Raji Raji shadow_word_pain 589 1888281 4715 6.09 34691 69324 40.7 40.7 33.9% 0.0% 0.0% 0.0% 9.59sec 17688808 400.47sec
Raji Raji shadow_word_pain ticks -589 15800526 39501 43.58 40618 81242 40.7 290.6 33.9% 0.0% 0.0% 0.0% 9.59sec 17688808 400.47sec
Raji Raji shadowform 232698 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Raji Raji shadowy_apparitions 78203 5983959 14942 25.18 26596 53188 169.5 168.1 33.9% 0.0% 0.0% 0.0% 2.33sec 5983959 400.47sec
Raji Raji vampiric_touch ticks -34914 32068253 80171 52.51 68452 136903 33.6 350.0 33.8% 0.0% 0.0% 0.0% 9.09sec 32068253 400.47sec
Raji Raji void_bolt 205448 20090254 50167 11.89 189058 378180 79.6 79.4 33.9% 0.0% 0.0% 0.0% 4.89sec 20090254 400.47sec
Raji Raji void_eruption 228360 3980875 9941 7.48 59550 119123 11.5 49.9 33.8% 0.0% 0.0% 0.0% 35.40sec 3980875 400.47sec
Raji Raji void_torrent ticks -205065 6107149 15268 6.28 108949 217785 6.9 41.9 33.9% 0.0% 0.0% 0.0% 61.20sec 6107149 400.47sec
Raji Raji volatile_ichor 222187 12301371 30718 10.90 126388 252851 21.5 72.8 33.8% 0.0% 0.0% 0.0% 18.42sec 12301371 400.47sec
Raji Raji_mindbender melee 0 6378558 60729 50.85 53521 107030 89.0 89.0 33.9% 0.0% 0.0% 0.0% 4.37sec 6378558 105.03sec
Raji Raji_mindbender shadowcrawl 63619 0 0 0.00 0 0 21.1 0.0 0.0% 0.0% 0.0% 0.0% 18.92sec 0 105.03sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 1893447 4734 6.72 31576 63153 8.9 44.8 33.9% 0.0% 0.0% 0.0% 41.55sec 1893447 62.20sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 415805 1040 1.47 31576 63153 2.0 9.8 33.9% 0.0% 0.0% 0.0% 62.09sec 415805 13.44sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 309216 773 1.10 31576 63153 1.4 7.3 33.4% 0.0% 0.0% 0.0% 15.27sec 309216 9.81sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 299145 748 1.05 31576 63153 1.4 7.0 35.3% 0.0% 0.0% 0.0% 4.73sec 299145 9.18sec
Raji Raji_void_tendril mind_flay_void_tendril ticks -193473 347341 868 1.35 31576 63153 1.0 9.0 22.2% 0.0% 0.0% 0.0% 0.00sec 347341 10.00sec
Vait Vait adrenaline_rush 13750 0 0 0.00 0 0 5.9 0.0 0.0% 0.0% 0.0% 0.0% 71.01sec 0 400.47sec
Vait Vait ambush 8676 1055077 2635 1.05 111667 224048 7.0 7.0 34.7% 0.0% 0.0% 0.0% 64.89sec 1551064 400.47sec
Vait Vait augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Vait Vait auto_attack_mh 0 8109698 20251 38.34 27023 54048 255.9 255.9 36.3% 19.0% 0.0% 0.0% 1.57sec 11922025 400.47sec
Vait Vait auto_attack_oh 1 3760855 9391 35.55 13515 27028 237.3 237.3 36.3% 19.0% 0.0% 0.0% 1.69sec 5528812 400.47sec
Vait Vait blade_flurry 13877 0 0 0.00 0 0 10.0 0.0 0.0% 0.0% 0.0% 0.0% 29.99sec 0 400.47sec
Vait Vait blade_flurry_attack 22482 31973351 79840 311.92 15358 0 416.4 2081.9 0.0% 0.0% 0.0% 0.0% 0.98sec 47003855 400.47sec
Vait Vait curse_of_the_dreadblades 202665 0 0 0.00 0 0 4.8 0.0 0.0% 0.0% 0.0% 0.0% 91.85sec 0 400.47sec
Vait Vait flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Vait Vait food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Vait Vait ghostly_strike 196937 1607959 4015 4.04 43852 87766 27.0 27.0 36.0% 0.0% 0.0% 0.0% 15.07sec 2363852 400.47sec
Vait Vait gouge 1776 0 0 0.00 0 0 19.9 0.0 0.0% 0.0% 0.0% 0.0% 18.28sec 0 400.47sec
Vait Vait greed 202822 13162802 32869 17.39 83171 166340 34.7 116.1 36.3% 0.0% 0.0% 0.0% 11.26sec 19350565 400.47sec
Vait Vait greed_oh 202823 6586822 16448 17.39 41584 83175 34.7 116.1 36.5% 0.0% 0.0% 0.0% 11.26sec 9683252 400.47sec
Vait Vait main_gauche 86392 9581955 23927 36.02 29247 58495 240.4 240.4 36.3% 0.0% 0.0% 0.0% 1.69sec 14086382 400.47sec
Vait Vait marked_for_death 137619 0 0 0.00 0 0 12.7 0.0 0.0% 0.0% 0.0% 0.0% 24.00sec 0 400.47sec
Vait Vait pistol_shot 185763 3018564 7538 6.53 44890 89773 43.6 43.6 54.2% 0.0% 0.0% 0.0% 8.64sec 4437576 400.47sec
Vait Vait potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Vait Vait potion_of_the_old_war 188028 4716413 11777 3.94 131879 264197 26.3 26.3 35.9% 0.0% 0.0% 0.0% 5.47sec 6933573 400.47sec
Vait Vait roll_the_bones 193316 0 0 0.00 0 0 16.3 0.0 0.0% 0.0% 0.0% 0.0% 24.32sec 0 400.47sec
Vait Vait run_through 2098 45690554 114093 14.91 336368 672098 99.5 99.5 36.6% 0.0% 0.0% 0.0% 3.98sec 67169443 400.47sec
Vait Vait saber_slash 193315 23610295 58957 32.43 80090 160184 216.5 216.5 36.2% 0.0% 0.0% 0.0% 1.85sec 34709370 400.47sec
Vait Vait sprint 2983 0 0 0.00 0 0 8.3 0.0 0.0% 0.0% 0.0% 0.0% 49.07sec 0 400.47sec
Vait Vait touch_of_the_grave 127802 1054748 2634 3.61 43751 0 24.1 24.1 0.0% 0.0% 0.0% 0.0% 16.91sec 1054748 400.47sec
Vait Vait vanish 1856 0 0 0.00 0 0 6.0 0.0 0.0% 0.0% 0.0% 0.0% 64.69sec 0 400.47sec
Bowflexn Bowflexn augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Bowflexn Bowflexn boulderfist 201897 14297416 35702 11.60 138641 282943 77.5 77.5 31.8% 0.0% 0.0% 0.0% 5.19sec 14297416 400.47sec
Bowflexn Bowflexn crash_lightning 187874 15464689 38617 39.17 44398 90573 65.0 261.5 31.9% 0.0% 0.0% 0.0% 6.10sec 15464689 400.47sec
Bowflexn Bowflexn crashing_storm 210801 15436716 38547 252.02 6884 14044 403.0 1682.1 32.0% 0.0% 0.0% 0.0% 0.98sec 15436716 400.47sec
Bowflexn Bowflexn doom_winds 204945 0 0 0.00 0 0 6.9 0.0 0.0% 0.0% 0.0% 0.0% 62.28sec 0 400.47sec
Bowflexn Bowflexn feral_spirit 51533 0 0 0.00 0 0 3.8 0.0 0.0% 0.0% 0.0% 0.0% 120.37sec 0 400.47sec
Bowflexn Bowflexn flametongue 193796 2692082 6722 4.54 66641 135988 30.3 30.3 32.0% 0.0% 0.0% 0.0% 13.29sec 2692082 400.47sec
Bowflexn Bowflexn flametongue_attack 10444 8989274 22447 164.32 6149 12544 1096.8 1096.8 32.0% 0.0% 0.0% 0.0% 1.15sec 8989274 400.47sec
Bowflexn Bowflexn flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Bowflexn Bowflexn food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Bowflexn Bowflexn frostbrand 196834 1677099 4188 3.67 51349 104762 24.5 24.5 32.0% 0.0% 0.0% 0.0% 16.55sec 1677099 400.47sec
Bowflexn Bowflexn hailstorm 210854 22265265 55598 160.85 15557 31739 1073.6 1073.6 32.0% 0.0% 0.0% 0.0% 1.18sec 22265265 400.47sec
Bowflexn Bowflexn lava_lash 60103 2589653 6467 2.52 115498 235623 16.8 16.8 32.0% 0.0% 0.0% 0.0% 22.67sec 2589653 400.47sec
Bowflexn Bowflexn lava_lash_cl 195592 1958173 4890 4.95 44393 90569 8.0 33.0 32.2% 0.0% 0.0% 0.0% 29.67sec 1958173 400.47sec
Bowflexn Bowflexn main_hand 0 3917398 9782 24.88 20663 42166 166.0 166.0 32.0% 19.1% 0.0% 0.0% 2.42sec 5758946 400.47sec
Bowflexn Bowflexn mark_of_the_hidden_satyr 191259 4612820 11519 3.66 141550 288920 24.4 24.4 32.0% 0.0% 0.0% 0.0% 16.31sec 4612820 400.47sec
Bowflexn Bowflexn offhand 1 1954648 4881 24.79 10335 21090 165.5 165.5 32.0% 19.0% 0.0% 0.0% 2.42sec 2873517 400.47sec
Bowflexn Bowflexn potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Bowflexn Bowflexn potion_of_the_old_war 188028 3551536 8868 3.22 124288 253735 21.5 21.5 31.7% 0.0% 0.0% 0.0% 7.29sec 5221095 400.47sec
Bowflexn Bowflexn storm_tempests 214452 1656567 4137 26.28 7085 14454 175.4 175.4 32.0% 0.0% 0.0% 0.0% 1.65sec 1656567 400.47sec
Bowflexn Bowflexn stormlash 213307 6246043 15597 78.84 11870 0 526.2 526.2 0.0% 0.0% 0.0% 0.0% 1.81sec 6246043 400.47sec
Bowflexn Bowflexn stormstrike 17364 0 0 0.00 0 0 112.4 0.0 0.0% 0.0% 0.0% 0.0% 3.52sec 0 400.47sec
Bowflexn Bowflexn stormstrike_cl 195592 21644763 54049 54.70 44475 90724 81.7 365.1 32.0% 0.0% 0.0% 0.0% 3.58sec 21644763 400.47sec
Bowflexn Bowflexn stormstrike_mh 32175 26993416 67405 21.07 144049 293516 140.6 140.6 32.1% 0.0% 0.0% 0.0% 3.52sec 39682879 400.47sec
Bowflexn Bowflexn stormstrike_offhand 32176 13498684 33707 21.07 71992 146898 140.6 140.6 32.0% 0.0% 0.0% 0.0% 3.52sec 19844345 400.47sec
Bowflexn Bowflexn unleash_lava 199053 3617784 9034 10.31 39387 80357 69.2 68.8 32.1% 0.0% 0.0% 0.0% 8.60sec 3617784 400.47sec
Bowflexn Bowflexn unleash_lightning 199054 3610250 9015 10.31 39383 80337 69.2 68.8 32.0% 0.0% 0.0% 0.0% 8.62sec 3610250 400.47sec
Bowflexn Bowflexn wind_shear 57994 0 0 0.00 0 0 14.4 0.0 0.0% 0.0% 0.0% 0.0% 28.27sec 0 400.47sec
Bowflexn Bowflexn windfury_attack 25504 8981115 22427 41.00 24624 50221 273.7 273.7 32.0% 0.0% 0.0% 0.0% 3.56sec 13203090 400.47sec
Bowflexn Bowflexn windfury_attack_oh 33750 1087929 2717 4.36 28024 57169 29.1 29.1 32.1% 0.0% 0.0% 0.0% 26.83sec 1599359 400.47sec
Bowflexn Bowflexn_frost_wolf frozen_bite 224126 1755947 74101 23.92 140586 281166 9.4 9.4 32.2% 0.0% 0.0% 0.0% 35.71sec 1755947 23.70sec
Bowflexn Bowflexn_frost_wolf melee 0 1057299 44618 115.49 17555 35119 45.6 45.6 32.0% 0.0% 0.0% 0.0% 6.68sec 1554329 23.70sec
Bowflexn Bowflexn_frost_wolf snowstorm 198483 1982281 83653 101.26 37498 74999 15.6 40.0 32.2% 0.0% 0.0% 0.0% 19.43sec 1982281 23.70sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws 224125 1177758 49607 24.08 93750 187439 9.5 9.5 31.8% 0.0% 0.0% 0.0% 36.06sec 2599846 23.74sec
Bowflexn Bowflexn_fiery_wolf fiery_jaws ticks -224125 1422089 3555 5.69 37488 0 9.5 37.9 0.0% 0.0% 0.0% 0.0% 36.06sec 2599846 23.74sec
Bowflexn Bowflexn_fiery_wolf fire_nova 198480 1995676 84057 101.78 37491 74991 15.7 40.3 32.2% 0.0% 0.0% 0.0% 19.58sec 1995676 23.74sec
Bowflexn Bowflexn_fiery_wolf melee 0 1065934 44897 116.06 17555 35119 45.9 45.9 32.2% 0.0% 0.0% 0.0% 6.78sec 1567024 23.74sec
Bowflexn Bowflexn_lightning_wolf crackling_surge 224127 0 0 0.00 0 0 9.5 0.0 0.0% 0.0% 0.0% 0.0% 35.85sec 0 23.55sec
Bowflexn Bowflexn_lightning_wolf melee 0 1514384 64315 119.04 24546 49131 46.7 46.7 32.0% 0.0% 0.0% 0.0% 6.27sec 2226287 23.55sec
Bowflexn Bowflexn_lightning_wolf thunder_bite 198485 2141444 90946 89.62 46133 92215 15.6 35.2 32.0% 0.0% 0.0% 0.0% 19.30sec 2141444 23.55sec
Alacastria Alacastria arcane_torrent 69179 0 0 0.00 0 0 4.9 0.0 0.0% 0.0% 0.0% 0.0% 90.29sec 0 400.47sec
Alacastria Alacastria augmentation 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Alacastria Alacastria auto_attack_mh 0 5156796 12877 24.63 25483 54446 164.4 164.4 20.3% 0.0% 0.0% 7.5% 2.45sec 7756385 400.47sec
Alacastria Alacastria battle_cry 1719 0 0 0.00 0 0 7.1 0.0 0.0% 0.0% 0.0% 0.0% 60.71sec 0 400.47sec
Alacastria Alacastria deep_wounds ticks -115767 20674444 51686 55.50 43498 93015 317.3 370.0 25.0% 0.0% 0.0% 0.0% 2.19sec 20674444 400.47sec
Alacastria Alacastria demoralizing_shout 1160 0 0 0.00 0 0 3.7 0.0 0.0% 0.0% 0.0% 0.0% 121.38sec 0 400.47sec
Alacastria Alacastria devastate 20243 13119487 32760 21.00 77478 164643 140.2 140.2 18.5% 0.0% 0.0% 7.5% 2.86sec 19732646 400.47sec
Alacastria Alacastria flask 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Alacastria Alacastria food 0 0 0 0.00 0 0 1.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Alacastria Alacastria gaseous_bubble 214972 11054556 27604 4.78 201322 410884 7.0 31.9 69.3% 0.0% 0.0% 0.0% 60.04sec 11054556 400.47sec
Alacastria Alacastria ignore_pain 190456 20229376 50514 35.53 85308 0 26.7 237.1 0.0% 0.0% 0.0% 0.0% 15.48sec 0 400.47sec
Alacastria Alacastria intercept 198304 0 0 0.00 0 0 20.1 0.0 0.0% 0.0% 0.0% 0.0% 20.42sec 0 400.47sec
Alacastria Alacastria neltharions_fury ticks -203524 14843099 37108 4.50 39074 82456 5.0 30.0 100.0% 0.0% 0.0% 0.0% 60.63sec 14843099 400.47sec
Alacastria Alacastria potion 0 0 0 0.00 0 0 2.0 0.0 0.0% 0.0% 0.0% 0.0% 0.00sec 0 400.47sec
Alacastria Alacastria revenge 6572 21411944 53467 26.54 95784 202868 42.5 177.1 23.4% 0.0% 0.0% 5.2% 9.24sec 31646782 400.47sec
Alacastria Alacastria shield_block 2565 0 0 0.00 0 0 28.8 0.0 0.0% 0.0% 0.0% 0.0% 14.26sec 0 400.47sec
Alacastria Alacastria shield_block_heavy_repercussions 2565 0 0 0.00 0 0 49.1 0.0 0.0% 0.0% 0.0% 0.0% 8.28sec 0 400.47sec
Alacastria Alacastria shield_slam 23922 13098085 32707 8.45 169674 362258 56.4 56.4 32.5% 0.0% 0.0% 7.5% 7.20sec 19698304 400.47sec
Alacastria Alacastria thunder_clap 6343 9768464 24393 24.40 46924 99414 27.1 162.9 24.9% 0.0% 0.0% 0.0% 10.88sec 14360567 400.47sec

Fluffy_Pillow : 74747 dps, 0 dps to main target

Results, Spec and Gear

DPS DPS(e) DPS Error DPS Range DPR
74746.7 74746.7 50.0 / 0.067% 9926.8 / 13.3% -1.0
RPS Out RPS In Primary Resource Waiting APM Active Skill
0.0 0.0 Mana 84.43% 5.5 100.0% 100%
Talents
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Scale Factors for other metrics

Scale Factors for Fluffy_Pillow Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Priority Target Damage Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Per Second (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Absorb Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Healing + Absorb per second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Damage Taken
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Healing Taken Per Second
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_Pillow Theck-Meloree Index
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking
Scale Factors for Fluffy_PillowTheck-Meloree Index (Effective)
Scale Factors
Normalized
Scale Deltas
Error
Gear Ranking
Optimizers
Ranking

Charts

Abilities

Damage Stats DPS DPS% Execute Interval DPE DPET Type Count Hit Crit Avg Crit% Avoid% B% Up%
Fluffy_Pillow 74747
melee_main_hand_Alacastria 9203 12.3% 198.7 2.00sec 18533 9266 Direct 186.2 22840 0 19783 0.0% 13.4% 60.8%  

Stats details: melee_main_hand_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.74 186.18 0.00 0.00 2.0000 0.0000 3683081.37 42693526.99 91.37 9266.31 9266.31
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 48.14 25.85% 34213.86 1 176314 34199.91 13757 61823 1646920 12745059 87.08
hit (blocked) 53.97 28.99% 23173.48 2 123420 23230.40 10299 43642 1250577 14288723 91.23
hit (crit blocked) 59.15 31.77% 13281.03 1 70526 13305.34 5712 25168 785585 15659745 94.97
parry 24.92 13.39% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_main_hand_Illistan 42070 56.3% 198.7 2.00sec 84831 42416 Direct 198.7 128555 0 84830 0.0% 34.0% 0.0%  

Stats details: melee_main_hand_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 198.74 198.74 0.00 0.00 2.0000 0.0000 16858951.76 34723154.82 51.45 42415.66 42415.66
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 131.14 65.99% 128554.55 45976 180046 128528.96 101851 135260 16858952 34723155 51.46
parry 47.72 24.01% 0.00 0 0 0.00 0 0 0 0 0.00
dodge 19.87 10.00% 0.00 0 0 0.00 0 0 0 0 0.00
 
 

Action details: melee_main_hand_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:5.0
  • travel_speed:0.0000
  • trigger_gcd:0.0000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:0.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:true
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:238283.10
  • base_dd_max:291234.90
Weapon
  • normalized:false
  • weapon_power_mod:0.285714
  • weapon_multiplier:1.00
 
melee_nuke_Alacastria 762 1.0% 14.0 29.10sec 21860 10930 Direct 12.1 25274 0 25274 0.0% 0.0% 74.7%  

Stats details: melee_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 12.11 0.00 0.00 2.0000 0.0000 306063.88 3792072.39 91.93 10930.46 10930.46
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 3.07 25.33% 34370.00 4 208338 32975.25 0 207803 105386 960217 86.16
hit (blocked) 4.40 36.30% 28271.48 7 145837 28093.11 0 144756 124286 1376239 90.60
hit (crit blocked) 4.65 38.37% 16435.99 0 83344 16360.06 0 82997 76392 1455616 94.36
 
 

Action details: melee_nuke_Alacastria

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
melee_nuke_Illistan 5276 7.1% 14.0 29.10sec 150893 75279 Direct 14.0 150892 0 150892 0.0% 0.0% 0.0%  

Stats details: melee_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 14.00 14.00 0.00 0.00 2.0045 0.0000 2112616.30 4379015.54 51.76 75278.52 75278.52
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 14.00 100.00% 150892.10 54336 212782 150822.96 118882 169823 2112616 4379016 51.78
 
 

Action details: melee_nuke_Illistan

Static Values
  • id:0
  • school:physical
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:27.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:281607.30
  • base_dd_max:344186.70
 
spell_dot_Alacastria 2720 3.6% 10.2 41.06sec 106970 106971 Periodic 92.0 11829 0 11829 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 99.11 92.02 1.0000 2.0000 1088533.68 5537342.24 80.34 5223.19 106970.68
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 92.0 100.00% 11828.87 0 55419 11837.39 5945 19472 1088534 5537342 80.33
 
 

Action details: spell_dot_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_dot_Illistan 11765 15.7% 10.2 41.06sec 462891 460854 Periodic 99.1 47525 0 47525 0.0% 0.0% 0.0% 49.5%

Stats details: spell_dot_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 10.18 0.00 99.11 99.11 1.0045 2.0000 4710388.45 5963999.44 21.02 22597.21 460853.97
  Simulation Iteration Average  
Tick Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 99.1 100.00% 47524.94 21799 51903 47528.72 46558 48695 4710388 5963999 21.01
 
 

Action details: spell_dot_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.0000
  • min_gcd:1.0000
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:40.000
  • base_execute_time:1.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:!ticking
Damage Over Time
  • tick_may_crit:false
  • tick_zero:false
  • attack_power_mod.tick:0.000000
  • spell_power_mod.tick:0.000000
  • base_td:60172.50
  • dot_duration:20.00
  • base_tick_time:2.00
  • hasted_ticks:true
  • dot_behavior:DOT_REFRESH
 
spell_nuke_Alacastria 642 0.9% 11.1 37.11sec 23078 11539 Direct 9.3 27576 0 27576 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Alacastria

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 9.33 0.00 0.00 2.0000 0.0000 257149.97 1234488.38 79.17 11539.15 11539.15
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 9.33 100.00% 27576.19 13 134110 27692.10 10276 91058 257150 1234488 79.08
 
 

Action details: spell_nuke_Alacastria

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Alacastria
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
spell_nuke_Illistan 2310 3.1% 11.1 37.11sec 83000 41408 Direct 11.1 83001 0 83001 0.0% 0.0% 0.0%  

Stats details: spell_nuke_Illistan

Type Executes Direct Results Ticks Tick Results Execute Time per Execution Tick Time per Tick Actual Amount Total Amount Overkill % Amount per Total Time Amount per Total Execute Time
damage 11.14 11.14 0.00 0.00 2.0045 0.0000 924856.37 1474854.80 37.29 41408.39 41408.39
  Simulation Iteration Average  
Direct Results Count Pct Mean Min Max Mean Min Max Actual Amount Total Amount Overkill %
hit 11.14 100.00% 83001.26 43162 125603 82970.30 75021 92055 924856 1474855 37.31
 
 

Action details: spell_nuke_Illistan

Static Values
  • id:0
  • school:fire
  • resource:none
  • range:-1.0
  • travel_speed:0.0000
  • trigger_gcd:1.5000
  • min_gcd:0.7500
  • base_cost:0.0
  • secondary_cost:0.0
  • cooldown:35.000
  • base_execute_time:2.00
  • base_crit:0.00
  • target:Illistan
  • harmful:true
  • if_expr:
Direct Damage
  • may_crit:false
  • attack_power_mod.direct:0.000000
  • spell_power_mod.direct:0.000000
  • base_dd_min:119141.55
  • base_dd_max:145617.45
 
Simple Action Stats Execute Interval
Fluffy_Pillow

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Health Decade (0 - 10) 1.0 0.0 0.0sec 0.0sec 9.59% 9.59% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (0 - 10)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (0 - 10)_1:9.59%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (10 - 20) 1.0 0.0 0.0sec 0.0sec 9.89% 9.89% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (10 - 20)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (10 - 20)_1:9.89%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (20 - 30) 1.0 0.0 0.0sec 0.0sec 10.66% 10.66% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (20 - 30)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (20 - 30)_1:10.66%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (30 - 40) 1.0 0.0 0.0sec 0.0sec 11.03% 11.03% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (30 - 40)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (30 - 40)_1:11.03%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (40 - 50) 1.0 0.0 0.0sec 0.0sec 11.02% 11.02% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (40 - 50)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (40 - 50)_1:11.02%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (50 - 60) 1.0 0.0 0.0sec 0.0sec 10.70% 10.70% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (50 - 60)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (50 - 60)_1:10.70%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (60 - 70) 1.0 0.0 0.0sec 0.0sec 10.72% 10.72% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (60 - 70)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (60 - 70)_1:10.72%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (70 - 80) 1.0 0.0 0.0sec 0.0sec 11.45% 11.45% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (70 - 80)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (70 - 80)_1:11.45%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (80 - 90) 1.0 0.0 0.0sec 0.0sec 9.87% 9.87% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (80 - 90)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (80 - 90)_1:9.87%

Trigger Attempt Success

  • trigger_pct:100.00%
Health Decade (90 - 100) 1.0 0.0 0.0sec 0.0sec 5.09% 5.09% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_Health Decade (90 - 100)
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • Health Decade (90 - 100)_1:5.09%

Trigger Attempt Success

  • trigger_pct:100.00%
Anguish 7.4 64.4 54.4sec 4.9sec 6.26% 6.26% 0.0(0.0) 7.3

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.32%
  • anguish_2:0.31%
  • anguish_3:0.31%
  • anguish_4:0.32%
  • anguish_5:0.31%
  • anguish_6:0.31%
  • anguish_7:0.31%
  • anguish_8:0.31%
  • anguish_9:0.31%
  • anguish_10:3.45%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Anguish 11.8 99.4 32.8sec 3.2sec 10.22% 10.22% 0.0(0.0) 11.7

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.69%
  • anguish_2:0.53%
  • anguish_3:0.53%
  • anguish_4:0.53%
  • anguish_5:0.51%
  • anguish_6:0.56%
  • anguish_7:0.51%
  • anguish_8:0.54%
  • anguish_9:0.53%
  • anguish_10:5.30%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Demoralizing Shout (_debuff) 3.7 0.0 121.8sec 121.4sec 7.40% 7.11% 0.0(0.0) 3.7

Buff details

  • buff initial source:Alacastria
  • cooldown name:buff_demoralizing_shout_debuff
  • max_stacks:1
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
  • default_value:-0.20

Stack Uptimes

  • demoralizing_shout_debuff_1:7.40%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:1160
  • name:Demoralizing Shout
  • tooltip:{$?s199023=false}[Demoralized, dealing $s1% less damage.][Demoralized, dealing $s1% less damage to the shouting Warrior.]
  • description:{$?s199023=false}[Demoralizes all enemies within $A2 yards, reducing the damage they do by $s1% for {$d=8 seconds}.][Demoralizes all enemies within $A2 yards, reducing the damage they do to you by $s1% for {$d=8 seconds}.]{$?s202743=false}[ |cFFFFFFFFGenerates ${$m5/10} Rage.|r][]
  • max_stacks:0
  • duration:8.00
  • cooldown:90.00
  • default_chance:101.00%
Ghostly Strike 5.6 21.4 67.7sec 15.1sec 96.47% 96.81% 103.6(103.6) 4.6

Buff details

  • buff initial source:Vait
  • cooldown name:buff_ghostly_strike
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.10

Stack Uptimes

  • ghostly_strike_1:96.47%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:196937
  • name:Ghostly Strike
  • tooltip:Taking $s5% increased damage from the Rogue's abilities.
  • description:Strikes an enemy with your cursed weapon, dealing $sw2 Physical damage and causing the target to take $s5% increased damage from your abilities for {$d=15 seconds}. |cFFFFFFFFAwards $s1 combo $lpoint:points;.|r
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 36.6 0.0 10.9sec 10.9sec 28.83% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:28.83%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Hunter's Mark 37.1 0.3 10.8sec 10.7sec 27.24% 100.00% 0.3(0.3) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:27.24%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Judgment 34.5 55.1 11.7sec 4.4sec 84.17% 92.90% 55.1(55.1) 33.7

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:84.17%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Marked for Death 0.5 0.4 3.4sec 7.6sec 7.75% 7.75% 0.4(0.4) 0.5

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:7.75%

Trigger Attempt Success

  • trigger_pct:45.38%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Open Wounds 8.9 2.2 38.7sec 31.9sec 54.73% 63.85% 2.2(2.2) 0.7

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:54.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Stellar Empowerment 15.2 0.0 19.6sec 19.6sec 5.77% 5.41% 0.0(0.0) 15.2

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:5.77%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Storm Tempests 1.0 139.6 185.3sec 2.8sec 98.86% 98.86% 487.1(487.1) 0.0

Buff details

  • buff initial source:Bowflexn
  • cooldown name:buff_storm_tempests
  • max_stacks:1
  • duration:15.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • storm_tempests_1:98.86%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:214265
  • name:Storm Tempests
  • tooltip:Zapping nearby allies every $t1 sec.
  • description:{$@spelldesc214260=Enemies hit by your Stormstrike become lightning charged for $s1 sec, zapping a nearby enemy every $214265t1 sec for $214452sw1 Nature damage.}
  • max_stacks:0
  • duration:15.00
  • cooldown:0.00
  • default_chance:0.00%
Vulnerable (vulnerability) 18.8 76.0 21.1sec 4.2sec 87.99% 94.21% 76.0(76.0) 17.8

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:87.99%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Vulnerable (vulnerability) 20.7 78.2 19.3sec 4.1sec 88.49% 89.88% 78.2(78.2) 19.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:88.49%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 96.49% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.49%
Add1: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.6 4.4 0.0sec 0.0sec 81.58% 95.89% 4.4(4.4) 13.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:81.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.82% 40.82% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 3.6 0.0 0.0sec 0.0sec 20.52% 46.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:20.52%

Trigger Attempt Success

  • trigger_pct:92.98%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 96.49% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.49%
Add2: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.0 0.0 8.8sec 1.5sec 0.04% 0.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.05%

Trigger Attempt Success

  • trigger_pct:0.46%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add3: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add4: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add5: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Constant Buffs
bleeding

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:95.23%
Mortal Wounds

Buff details

  • buff initial source:Fluffy_Pillow
  • cooldown name:buff_mortal_wounds
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.25

Stack Uptimes

  • mortal_wounds_1:100.00%

Spelldata details

  • id:115804
  • name:Mortal Wounds
  • tooltip:Healing effects received reduced by $w1%.
  • description:Grievously wounds the target, reducing the effectiveness of any healing received for {$115804d=10 seconds}.
  • max_stacks:0
  • duration:10.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow
Resource RPS-Gain RPS-Loss
Health 0.00 3532467.88
Combat End Resource Mean Min Max
Health 0.00 0.00 0.00

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Deaths

death count 12926
death count pct 129.22
avg death time 400.25
min death time 306.84
max death time 492.22
dmg taken 1414761437.94

Statistics & Data Analysis

Fight Length
Sample Data Fluffy_Pillow Fight Length
Count 9999
Mean 400.47
Minimum 306.84
Maximum 492.22
Spread ( max - min ) 185.38
Range [ ( max - min ) / 2 * 100% ] 23.15%
DPS
Sample Data Fluffy_Pillow Damage Per Second
Count 9999
Mean 74746.66
Minimum 60133.12
Maximum 84166.18
Spread ( max - min ) 24033.06
Range [ ( max - min ) / 2 * 100% ] 16.08%
Standard Deviation 2552.9108
5th Percentile 70579.94
95th Percentile 78935.80
( 95th Percentile - 5th Percentile ) 8355.86
Mean Distribution
Standard Deviation 25.5304
95.00% Confidence Intervall ( 74696.62 - 74796.70 )
Normalized 95.00% Confidence Intervall ( 99.93% - 100.07% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 44
0.1% Error 4481
0.1 Scale Factor Error with Delta=300 55635
0.05 Scale Factor Error with Delta=300 222543
0.01 Scale Factor Error with Delta=300 5563587
Priority Target DPS
Sample Data Fluffy_Pillow Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Fluffy_Pillow Damage Per Second (Effective)
Count 9999
Mean 74746.66
Minimum 60133.12
Maximum 84166.18
Spread ( max - min ) 24033.06
Range [ ( max - min ) / 2 * 100% ] 16.08%
Damage
Sample Data Fluffy_Pillow Damage
Count 9999
Mean 29941641.77
Minimum 20780028.52
Maximum 39889009.60
Spread ( max - min ) 19108981.09
Range [ ( max - min ) / 2 * 100% ] 31.91%
DTPS
Sample Data Fluffy_Pillow Damage Taken Per Second
Count 9999
Mean 3534444.52
Minimum 3408544.33
Maximum 3701170.86
Spread ( max - min ) 292626.54
Range [ ( max - min ) / 2 * 100% ] 4.14%
Standard Deviation 38029.4252
5th Percentile 3473431.06
95th Percentile 3599780.57
( 95th Percentile - 5th Percentile ) 126349.51
Mean Distribution
Standard Deviation 380.3133
95.00% Confidence Intervall ( 3533699.12 - 3535189.92 )
Normalized 95.00% Confidence Intervall ( 99.98% - 100.02% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 4
0.1% Error 444
0.1 Scale Factor Error with Delta=300 12345912
0.05 Scale Factor Error with Delta=300 49383649
0.01 Scale Factor Error with Delta=300 1234591242
HPS
Sample Data Fluffy_Pillow Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Fluffy_Pillow Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Fluffy_Pillow Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Fluffy_Pillow Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Fluffy_Pillow Theck-Meloree Index
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Fluffy_PillowTheck-Meloree Index (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Fluffy_Pillow Max Spike Value
Count 2499
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

actions.precombat Executed before combat begins. Accepts non-harmful actions only.
# count action,conditions
0 0.00 snapshot_stats
Default action list Executed every time the actor is available.
# count action,conditions
1 1.00 auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
2 10.20 spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
3 11.20 spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
4 14.07 melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1

Sample Sequence

123443243243424324324342342434234234

Sample Sequence Table

time name target resources buffs
0:00.000 auto_attack_tanks Illistan 1410197174.2/1410427164: 100% health vulnerability, vulnerability
0:02.000 spell_dot_Illistan Illistan 1398601036.4/1410427164: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:03.006 spell_nuke_Illistan Illistan 1393393732.2/1410427164: 99% health ghostly_strike, demoralizing_shout_debuff, vulnerability, vulnerability
0:05.011 melee_nuke_Illistan Illistan 1375164107.6/1410427164: 97% health ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
0:07.015 Waiting 27.000 sec 1357588206.8/1410427164: 96% health ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
0:34.015 melee_nuke_Illistan Illistan 1209649643.1/1410427164: 86% health Health Decade (80 - 90), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, vulnerability
0:36.020 Waiting 4.000 sec 1200149716.0/1410427164: 85% health Health Decade (80 - 90), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
0:40.020 spell_nuke_Illistan Illistan 1184174580.7/1410427164: 84% health Health Decade (80 - 90), ghostly_strike, storm_tempests, stellar_empowerment, vulnerability, hunters_mark, vulnerability, judgment
0:42.024 Waiting 1.000 sec 1176763270.6/1410427164: 83% health Health Decade (80 - 90), ghostly_strike, storm_tempests, hunters_mark, vulnerability, judgment
0:43.024 spell_dot_Illistan Illistan 1172976742.6/1410427164: 83% health Health Decade (80 - 90), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, judgment
0:44.030 Waiting 19.000 sec 1169759743.9/1410427164: 83% health Health Decade (80 - 90), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, judgment
1:03.030 melee_nuke_Illistan Illistan 1125271462.1/1410427164: 80% health Health Decade (70 - 80), ghostly_strike, storm_tempests, stellar_empowerment, vulnerability, vulnerability, judgment
1:05.035 Waiting 12.000 sec 1117581510.1/1410427164: 79% health Health Decade (70 - 80), ghostly_strike, storm_tempests, vulnerability, judgment
1:17.035 spell_nuke_Illistan Illistan 1077879397.6/1410427164: 76% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
1:19.039 Waiting 5.000 sec 1072391633.5/1410427164: 76% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
1:24.039 spell_dot_Illistan Illistan 1059397734.5/1410427164: 75% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
1:25.045 Waiting 7.000 sec 1056621725.8/1410427164: 75% health Health Decade (70 - 80), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, judgment
1:32.045 melee_nuke_Illistan Illistan 1030132813.5/1410427164: 73% health Health Decade (70 - 80), ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
1:34.050 Waiting 20.000 sec 1022632485.3/1410427164: 73% health Health Decade (70 - 80), ghostly_strike, storm_tempests, vulnerability, vulnerability, judgment
1:54.050 spell_nuke_Illistan Illistan 956195190.0/1410427164: 68% health Health Decade (60 - 70), storm_tempests, open_wounds, vulnerability, vulnerability, judgment
1:56.055 Waiting 5.000 sec 950447710.5/1410427164: 67% health Health Decade (60 - 70), anguish(5), anguish(9), storm_tempests, open_wounds, vulnerability, vulnerability, judgment
2:01.055 melee_nuke_Illistan Illistan 937491517.6/1410427164: 66% health Health Decade (60 - 70), ghostly_strike, storm_tempests, vulnerability, vulnerability
2:03.059 Waiting 2.000 sec 929056906.8/1410427164: 66% health Health Decade (60 - 70), ghostly_strike, storm_tempests, vulnerability, judgment
2:05.059 spell_dot_Illistan Illistan 921308552.4/1410427164: 65% health Health Decade (60 - 70), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, hunters_mark, vulnerability, judgment
2:06.062 Waiting 24.000 sec 917065023.6/1410427164: 65% health Health Decade (60 - 70), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
2:30.062 melee_nuke_Illistan Illistan 828463980.1/1410427164: 59% health Health Decade (50 - 60), ghostly_strike, storm_tempests, stellar_empowerment, open_wounds, hunters_mark, vulnerability, vulnerability, judgment
2:32.065 spell_nuke_Illistan Illistan 821476881.4/1410427164: 58% health Health Decade (50 - 60), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
2:34.070 Waiting 12.000 sec 813989691.5/1410427164: 58% health Health Decade (50 - 60), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
2:46.070 spell_dot_Illistan Illistan 776292866.2/1410427164: 55% health Health Decade (50 - 60), ghostly_strike, storm_tempests, hunters_mark, vulnerability, vulnerability, judgment
2:47.075 Waiting 12.000 sec 772606524.4/1410427164: 55% health Health Decade (50 - 60), ghostly_strike, storm_tempests, hunters_mark, vulnerability, judgment
2:59.075 melee_nuke_Illistan Illistan 731798531.7/1410427164: 52% health Health Decade (50 - 60), anguish(10), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
3:01.079 Waiting 8.000 sec 724350162.8/1410427164: 51% health Health Decade (50 - 60), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability
3:09.079 spell_nuke_Illistan Illistan 696286320.7/1410427164: 49% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
3:11.084 Waiting 16.000 sec 690698510.7/1410427164: 49% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability
3:27.084 spell_dot_Illistan Illistan 639721607.2/1410427164: 45% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, judgment
3:28.088 melee_nuke_Illistan Illistan 635824305.1/1410427164: 45% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, judgment
3:30.091 Waiting 16.000 sec 628562140.3/1410427164: 45% health Health Decade (40 - 50), anguish(10), ghostly_strike, storm_tempests, stellar_empowerment, vulnerability, hunters_mark, vulnerability, judgment
3:46.091 spell_nuke_Illistan Illistan 580540548.8/1410427164: 41% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
3:48.095 Waiting 9.000 sec 573603673.4/1410427164: 41% health Health Decade (40 - 50), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, judgment
3:57.095 melee_nuke_Illistan Illistan 550198437.7/1410427164: 39% health Health Decade (30 - 40), anguish, ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
3:59.100 Waiting 9.000 sec 544359914.6/1410427164: 39% health Health Decade (30 - 40), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:08.100 spell_dot_Illistan Illistan 514565115.3/1410427164: 36% health Health Decade (30 - 40), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, hunters_mark, vulnerability, judgment
4:09.103 Waiting 14.000 sec 510330920.7/1410427164: 36% health Health Decade (30 - 40), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
4:23.103 spell_nuke_Illistan Illistan 454256415.1/1410427164: 32% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability
4:25.107 Waiting 1.000 sec 448087695.6/1410427164: 32% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:26.107 melee_nuke_Illistan Illistan 443781665.6/1410427164: 31% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:28.111 Waiting 21.000 sec 437871677.9/1410427164: 31% health Health Decade (30 - 40), ghostly_strike, storm_tempests, open_wounds, vulnerability, judgment
4:49.111 spell_dot_Illistan Illistan 368813024.9/1410427164: 26% health Health Decade (20 - 30), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
4:50.114 Waiting 5.000 sec 365195486.2/1410427164: 26% health Health Decade (20 - 30), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
4:55.114 melee_nuke_Illistan Illistan 353150615.2/1410427164: 25% health Health Decade (20 - 30), storm_tempests, open_wounds, vulnerability, vulnerability, judgment
4:57.118 Waiting 3.000 sec 345859865.4/1410427164: 25% health Health Decade (20 - 30), anguish, ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
5:00.118 spell_nuke_Illistan Illistan 334789817.9/1410427164: 24% health Health Decade (20 - 30), anguish(10), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
5:02.123 Waiting 22.000 sec 330250041.1/1410427164: 23% health Health Decade (20 - 30), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
5:24.123 melee_nuke_Illistan Illistan 263231503.9/1410427164: 19% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:26.128 Waiting 4.000 sec 255830528.5/1410427164: 18% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, vulnerability, vulnerability, judgment
5:30.128 spell_dot_Illistan Illistan 245850568.8/1410427164: 17% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, vulnerability
5:31.134 Waiting 6.000 sec 241879144.7/1410427164: 17% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
5:37.134 spell_nuke_Illistan Illistan 219708418.3/1410427164: 16% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, vulnerability, hunters_mark, vulnerability, judgment
5:39.140 Waiting 14.000 sec 210305830.0/1410427164: 15% health Health Decade (10 - 20), ghostly_strike, storm_tempests, open_wounds, hunters_mark, vulnerability, vulnerability
5:53.140 melee_nuke_Illistan Illistan 160913951.4/1410427164: 11% health Health Decade (10 - 20), ghostly_strike, storm_tempests, hunters_mark, vulnerability, vulnerability, judgment
5:55.143 Waiting 16.000 sec 153105047.0/1410427164: 11% health Health Decade (10 - 20), ghostly_strike, storm_tempests, hunters_mark, vulnerability, vulnerability, judgment
6:11.143 spell_dot_Illistan Illistan 91331634.4/1410427164: 6% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
6:12.148 Waiting 2.000 sec 86668681.5/1410427164: 6% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment
6:14.148 spell_nuke_Illistan Illistan 76629663.3/1410427164: 5% health Health Decade (0 - 10), ghostly_strike, storm_tempests, demoralizing_shout_debuff, vulnerability, vulnerability, judgment
6:16.154 Waiting 6.000 sec 69169216.3/1410427164: 5% health Health Decade (0 - 10), ghostly_strike, storm_tempests, hunters_mark, vulnerability, vulnerability
6:22.154 melee_nuke_Illistan Illistan 47219191.3/1410427164: 3% health Health Decade (0 - 10), ghostly_strike, storm_tempests, vulnerability, hunters_mark, vulnerability, judgment
6:24.160 Waiting 12.000 sec 39008195.6/1410427164: 3% health Health Decade (0 - 10), ghostly_strike, storm_tempests, hunters_mark, vulnerability, hunters_mark, vulnerability, judgment

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696285256 0
Melee Crit 0.00% 5.00% 0
Spell Crit 0.00% 0.00% 0
Haste INF% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mitigation Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 0 3474 3474
Tank-Miss 0.00% 3.00% 0
Tank-Dodge 0.00% 3.00% 0
Tank-Parry 0.00% 3.00% 0
Tank-Block 0.00% 3.00% 0
Tank-Crit 0.00% 0.00% 0

Gear

Source Slot Average Item Level: 0.00

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

enemy="Fluffy_Pillow"
level=113
race=humanoid
role=tank
position=front
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.
actions.precombat=snapshot_stats

# Executed every time the actor is available.
actions=auto_attack,damage=264759.004,attack_speed=2,aoe_tanks=1
actions+=/spell_dot,damage=60172.501,tick_time=2,dot_duration=20,cooldown=40,aoe_tanks=1,if=!ticking
actions+=/spell_nuke,damage=132379.502,cooldown=35,attack_speed=2,aoe_tanks=1
actions+=/melee_nuke,damage=312897.004,cooldown=27,attack_speed=2,aoe_tanks=1


# Gear Summary
# gear_ilvl=0.00

Fluffy_Pillow_Add1 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add1: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: bleeding 10.0 0.0 0.0sec 0.0sec 96.49% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add1
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.49%
Add1: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Judgment 18.6 4.4 0.0sec 0.0sec 81.58% 95.89% 4.4(4.4) 13.0

Buff details

  • buff initial source:Zipi
  • cooldown name:buff_judgment
  • max_stacks:1
  • duration:8.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • judgment_1:81.58%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197277
  • name:Judgment
  • tooltip:Taking $w1% increased damage from the Paladin's Holy Power consuming abilities.
  • description:{$@spelldesc20271=Judges the target{$?s218178=false}[ and up to ${$231661s1+$218178s2} other nearby enemies]?s231661[ and $231661m1 other nearby $Lenemy:enemies;][], dealing $s1 Holy damage{$?s76672=false}|a231663[, and causing them to take $197277s1% increased damage taken from your Holy Power spenders for {$197277d=8 seconds}]?s231644[, and causing the target to take $214222s2% increased damage from your Crusader Strike and Holy Shock for {$214222d=6 seconds}]?a231657[, and reducing the remaining cooldown on Shield of the Righteous by $231657s1 sec, or ${$231657s1*2} sec on a critical strike][].}
  • max_stacks:0
  • duration:8.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Marked for Death 9.9 2.0 0.0sec 0.0sec 40.82% 40.82% 2.0(2.0) 0.0

Buff details

  • buff initial source:Vait
  • cooldown name:buff_marked_for_death
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • marked_for_death_1:40.82%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:137619
  • name:Marked for Death
  • tooltip:Marked for Death will reset upon death.
  • description:Marks the target, instantly generating $s1 combo points. Cooldown reset if the target dies within {$d=60 seconds}.
  • max_stacks:0
  • duration:60.00
  • cooldown:60.00
  • default_chance:0.00%
Add1: Open Wounds 3.6 0.0 0.0sec 0.0sec 20.52% 46.25% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:20.52%

Trigger Attempt Success

  • trigger_pct:92.98%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add1: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add1: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add1: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add1
Resource RPS-Gain RPS-Loss
Health 0.00 1039125.44
Combat End Resource Mean Min Max
Health 1395617035.48 1109759876.88 1678501158.56

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add1 Fight Length
Count 9999
Mean 200.00
Minimum 196.84
Maximum 200.00
Spread ( max - min ) 3.16
Range [ ( max - min ) / 2 * 100% ] 0.79%
DPS
Sample Data Add1 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add1 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add1 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add1 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add1 Damage Taken Per Second
Count 9999
Mean 1039125.49
Minimum 961125.28
Maximum 1115850.45
Spread ( max - min ) 154725.17
Range [ ( max - min ) / 2 * 100% ] 7.44%
HPS
Sample Data Add1 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add1 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add1 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add1 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add1 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add1Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add1 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696267586 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add1"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add2 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add2: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: bleeding 10.0 0.0 0.0sec 0.0sec 96.49% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add2
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:96.49%
Add2: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Open Wounds 0.0 0.0 8.8sec 1.5sec 0.04% 0.12% 0.0(0.0) 0.0

Buff details

  • buff initial source:Oinkie
  • cooldown name:buff_open_wounds
  • max_stacks:1
  • duration:60.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:0.15

Stack Uptimes

  • open_wounds_1:0.05%

Trigger Attempt Success

  • trigger_pct:0.46%

Spelldata details

  • id:210670
  • name:Open Wounds
  • tooltip:$s1% of armor is being ignored.
  • description:{$@spelldesc210666=The Fangs of Ashamane tear deep into your target, causing your attacks to ignore $210670s1% of the target's armor while Rip is active.}
  • max_stacks:0
  • duration:60.00
  • cooldown:0.00
  • default_chance:0.00%
Add2: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add2: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add2: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add2
Resource RPS-Gain RPS-Loss
Health 0.00 955345.92
Combat End Resource Mean Min Max
Health 1396704990.39 1111440618.54 1679216122.61

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add2 Fight Length
Count 9999
Mean 200.00
Minimum 196.84
Maximum 200.00
Spread ( max - min ) 3.16
Range [ ( max - min ) / 2 * 100% ] 0.79%
DPS
Sample Data Add2 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add2 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add2 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add2 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add2 Damage Taken Per Second
Count 9999
Mean 955345.99
Minimum 892557.30
Maximum 1033527.38
Spread ( max - min ) 140970.08
Range [ ( max - min ) / 2 * 100% ] 7.38%
HPS
Sample Data Add2 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add2 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add2 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add2 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add2 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add2Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add2 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696267586 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add2"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add3 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add3: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add3
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add3: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add3: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add3: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add3: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add3
Resource RPS-Gain RPS-Loss
Health 0.00 845285.41
Combat End Resource Mean Min Max
Health 1398916059.41 1113868557.22 1680530436.25

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add3 Fight Length
Count 9999
Mean 200.00
Minimum 196.84
Maximum 200.00
Spread ( max - min ) 3.16
Range [ ( max - min ) / 2 * 100% ] 0.79%
DPS
Sample Data Add3 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add3 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add3 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add3 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add3 Damage Taken Per Second
Count 9999
Mean 845285.49
Minimum 774476.45
Maximum 914564.65
Spread ( max - min ) 140088.20
Range [ ( max - min ) / 2 * 100% ] 8.29%
HPS
Sample Data Add3 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add3 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add3 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add3 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add3 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add3Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add3 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696267586 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add3"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add4 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add4: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add4
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add4: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add4: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add4: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add4: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add4
Resource RPS-Gain RPS-Loss
Health 0.00 829298.15
Combat End Resource Mean Min Max
Health 1399252117.89 1114609134.67 1682310111.89

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add4 Fight Length
Count 9999
Mean 200.00
Minimum 196.84
Maximum 200.00
Spread ( max - min ) 3.16
Range [ ( max - min ) / 2 * 100% ] 0.79%
DPS
Sample Data Add4 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add4 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add4 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add4 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add4 Damage Taken Per Second
Count 9999
Mean 829298.17
Minimum 762117.97
Maximum 911295.22
Spread ( max - min ) 149177.25
Range [ ( max - min ) / 2 * 100% ] 8.99%
HPS
Sample Data Add4 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add4 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add4 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add4 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add4 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add4Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add4 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696267586 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add4"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

Fluffy_Pillow_Add5 : 0 dps, 0 dps to main target

Results

Charts

Abilities

Buffs

Dynamic Buffs Start Refresh Interval Trigger Up-Time Benefit Overflow Expiry
Add5: Anguish 5.3 44.6 0.0sec 0.0sec 8.43% 8.43% 0.0(0.0) 4.8

Buff details

  • buff initial source:Táunks
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:0.44%
  • anguish_2:0.43%
  • anguish_3:0.43%
  • anguish_4:0.42%
  • anguish_5:0.42%
  • anguish_6:0.41%
  • anguish_7:0.40%
  • anguish_8:0.41%
  • anguish_9:0.41%
  • anguish_10:4.65%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Anguish 9.5 78.9 0.0sec 0.0sec 16.05% 16.05% 0.0(0.0) 9.2

Buff details

  • buff initial source:Mortwraith
  • cooldown name:buff_anguish
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:-0.00

Stack Uptimes

  • anguish_1:1.15%
  • anguish_2:0.82%
  • anguish_3:0.80%
  • anguish_4:0.79%
  • anguish_5:0.79%
  • anguish_6:0.89%
  • anguish_7:0.80%
  • anguish_8:0.87%
  • anguish_9:0.83%
  • anguish_10:8.32%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:202443
  • name:Anguish
  • tooltip:Suffering from Anguish of the Deceiver.
  • description:{$@spelldesc201473=Each time Eye Beam deals damage to a target, it also applies Anguish. When Anguish expires, it deals $202446s1 Chaos damage to the victim per application.}
  • max_stacks:30
  • duration:2.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: bleeding 10.0 0.0 0.0sec 0.0sec 89.77% 100.00% 0.0(0.0) 0.0

Buff details

  • buff initial source:Fluffy_Pillow_Add5
  • cooldown name:buff_bleeding
  • max_stacks:1
  • duration:0.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • bleeding_1:89.77%
Add5: Hunter's Mark 17.5 0.0 0.0sec 0.0sec 13.68% 76.76% 0.0(0.0) 0.0

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.68%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Hunter's Mark 17.8 0.0 0.0sec 0.0sec 13.50% 78.15% 0.0(0.0) 0.0

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_hunters_mark
  • max_stacks:1
  • duration:12.00
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:-0.00

Stack Uptimes

  • hunters_mark_1:13.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:185365
  • name:Hunter's Mark
  • tooltip:Vulnerabilities are exposed.
  • description:Mark the target, causing it to be vulnerable to your attacks for a short duration.
  • max_stacks:0
  • duration:12.00
  • cooldown:0.00
  • default_chance:0.00%
Add5: Stellar Empowerment 15.2 0.0 0.0sec 0.0sec 10.73% 12.81% 0.0(0.0) 13.3

Buff details

  • buff initial source:Madarii
  • cooldown name:buff_stellar_empowerment
  • max_stacks:1
  • duration:1.50
  • cooldown:0.00
  • default_chance:100.00%
  • default_value:0.20

Stack Uptimes

  • stellar_empowerment_1:10.73%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:197637
  • name:Stellar Empowerment
  • tooltip:Taking $w1% additional damage from the Druid's Moonfire and Sunfire.
  • description:Increases damage taken from your Moonfire and Sunfire by $197637s1%.
  • max_stacks:0
  • duration:1.50
  • cooldown:0.00
  • default_chance:0.00%
Add5: Vulnerable (vulnerability) 15.7 20.7 0.0sec 0.0sec 58.50% 76.77% 20.7(20.7) 8.5

Buff details

  • buff initial source:Sarkul
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:58.50%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%
Add5: Vulnerable (vulnerability) 17.3 21.2 0.0sec 0.0sec 62.41% 78.13% 21.2(21.2) 9.7

Buff details

  • buff initial source:Rothlandra
  • cooldown name:buff_vulnerability
  • max_stacks:1
  • duration:6.00
  • cooldown:0.00
  • default_chance:101.00%
  • default_value:1.50

Stack Uptimes

  • vulnerability_1:62.41%

Trigger Attempt Success

  • trigger_pct:100.00%

Spelldata details

  • id:187131
  • name:Vulnerable
  • tooltip:Damage taken from Marked Shot and Aimed Shot increased by $w2%. $?a190529[ Aimed Shot critical strike chance increased by $w3%.][]
  • description:Damage taken from Marked Shot and Aimed Shot increased by $s2% for {$d=30 seconds}.$?a231551[ Stacks up to {$u=1} times.][]
  • max_stacks:1
  • duration:30.00
  • cooldown:0.00
  • default_chance:101.00%

Resources

Resource Usage Type Count Total Average RPE APR
Fluffy_Pillow_Add5
Resource RPS-Gain RPS-Loss
Health 0.00 845154.74
Combat End Resource Mean Min Max
Health 1399124665.42 1113497001.05 1681017638.03

Benefits & Uptimes

Benefits %
Uptimes %

Procs

Count Interval

Statistics & Data Analysis

Fight Length
Sample Data Add5 Fight Length
Count 9999
Mean 200.00
Minimum 196.84
Maximum 200.00
Spread ( max - min ) 3.16
Range [ ( max - min ) / 2 * 100% ] 0.79%
DPS
Sample Data Add5 Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Priority Target DPS
Sample Data Add5 Priority Target Damage Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
DPS(e)
Sample Data Add5 Damage Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Damage
Sample Data Add5 Damage
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
DTPS
Sample Data Add5 Damage Taken Per Second
Count 9999
Mean 845154.78
Minimum 777798.50
Maximum 920852.49
Spread ( max - min ) 143053.99
Range [ ( max - min ) / 2 * 100% ] 8.46%
HPS
Sample Data Add5 Healing Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
HPS(e)
Sample Data Add5 Healing Per Second (Effective)
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Heal
Sample Data Add5 Heal
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
HTPS
Sample Data Add5 Healing Taken Per Second
Count 9999
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
TMI
Sample Data Add5 Theck-Meloree Index
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
ETMI
Sample Data Add5Theck-Meloree Index (Effective)
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0
MSD
Sample Data Add5 Max Spike Value
Count 0
Mean 0.00
Minimum 0.00
Maximum 0.00
Spread ( max - min ) 0.00
Range [ ( max - min ) / 2 * 100% ] 0.00%
Standard Deviation 0.0000
5th Percentile 0.00
95th Percentile 0.00
( 95th Percentile - 5th Percentile ) 0.00
Mean Distribution
Standard Deviation 0.0000
95.00% Confidence Intervall ( 0.00 - 0.00 )
Normalized 95.00% Confidence Intervall ( 0.00% - 0.00% )
Approx. Iterations needed for ( always use n>=50 )
1% Error 0
0.1% Error 0
0.1 Scale Factor Error with Delta=300 0
0.05 Scale Factor Error with Delta=300 0
0.01 Scale Factor Error with Delta=300 0

Action Priority List

Default action list Executed every time the actor is available.
# count action,conditions
0 0.00 snapshot_stats

Stats

Raid-Buffed Unbuffed Gear Amount
Strength 0 0 0
Agility 0 0 0
Stamina 0 0 0
Intellect 0 0 0
Spirit 0 0 0
Health 0 1696267586 0
Crit 5.00% 5.00% 0
Haste 0.00% 0.00% 0
Damage / Heal Versatility 0.00% 0.00% 0
Mastery 0.00% 0.00% 0
Armor 3474 3474 0
Run Speed 7 0 0

Talents

Level
15 none none none
30 none none none
45 none none none
60 none none none
75 none none none
90 none none none
100 none none none

Profile

add="Add5"
level=113
race=none
role=auto
position=back
talents=0000000
spec=unknown

# This default action priority list is automatically created based on your character.
# It is a attempt to provide you with a action list that is both simple and practicable,
# while resulting in a meaningful and good simulation. It may not result in the absolutely highest possible dps.
# Feel free to edit, adapt and improve it to your own needs.
# SimulationCraft is always looking for updates and improvements to the default action lists.

# Executed before combat begins. Accepts non-harmful actions only.

# Executed every time the actor is available.
actions=snapshot_stats

APM

Average number of actions executed per minute.

APS

Average absorption per active player duration.

Constant Buffs

Buffs received prior to combat and present the entire fight.

Count

Average number of times an action is executed per iteration.

Crit

Average crit damage.

Crit%

Percentage of executes that resulted in critical strikes.

DPE

Average damage per execution of an individual action.

DPET

Average damage per execute time of an individual action; the amount of damage generated, divided by the time taken to execute the action, including time spent in the GCD.

DPR

Average damage per resource point spent.

DPS

Average damage per active player duration.

DPSE

Average damage per fight duration.

DTPS

Average damage taken per second per active player duration.

HPS

Average healing (and absorption) per active player duration.

HPSE

Average healing (and absorption) per fight duration.

HPE

Average healing (or absorb) per execution of an individual action.

HPET

Average healing (or absorb) per execute time of an individual action; the amount of healing generated, divided by the time taken to execute the action, including time spent in the GCD.

HPR

Average healing (or absorb) per resource point spent.

Impacts

Average number of impacts against a target (for attacks that hit multiple times per execute) per iteration.

Dodge%

Percentage of executes that resulted in dodges.

DPS%

Percentage of total DPS contributed by a particular action.

HPS%

Percentage of total HPS (including absorb) contributed by a particular action.

Theck-Meloree Index

Measure of damage smoothness, calculated over entire fight length. Related to max spike damage, 1k TMI is roughly equivalent to 1% of your health. TMI ignores external healing and absorbs. Lower is better.

TMI bin size

Time bin size used to calculate TMI and MSD, in seconds.

Type

Direct or Periodic damage.

Max Spike Damage Frequency

This is roughly how many spikes as large as MSD Mean you take per iteration. Calculated from TMI and MSD values.

Dynamic Buffs

Temporary buffs received during combat, perhaps multiple times.

Glance%

Percentage of executes that resulted in glancing blows.

Block%

Percentage of executes that resulted in blocking blows.

Id

Associated spell-id for this ability.

Ability

Name of the ability.

Total

Total damage for this ability during the fight.

Hit

Average non-crit damage.

Interval

Average time between executions of a particular action.

Avg

Average direct damage per execution.

Miss%

Percentage of executes that resulted in misses, dodges or parries.

Origin

The player profile from which the simulation script was generated. The profile must be copied into the same directory as this HTML file in order for the link to work.

Parry%

Percentage of executes that resulted in parries.

RPS In

Average primary resource points generated per second.

RPS Out

Average primary resource points consumed per second.

Scale Factors

Gain per unit stat increase except for Hit/Expertise which represent Loss per unit stat decrease.

Gear Amount

Amount from raw gear, before class, attunement, or buff modifiers. Amount from hybrid primary stats (i.e. Agility/Intellect) shown in parentheses.

Stats Raid Buffed

Amount after all static buffs have been accounted for. Dynamic buffs (i.e. trinkets, potions) not included.

Stats Unbuffed

Amount after class modifiers and effects, but before buff modifiers.

Ticks

Average number of periodic ticks per iteration. Spells that do not have a damage-over-time component will have zero ticks.

Ticks Crit

Average crit tick damage.

Ticks Crit%

Percentage of ticks that resulted in critical strikes.

Ticks Hit

Average non-crit tick damage.

Ticks Miss%

Percentage of ticks that resulted in misses, dodges or parries.

Ticks Uptime%

Percentage of total time that DoT is ticking on target.

Ticks Avg

Average damage per tick.

Timeline Distribution

The simulated encounter's duration can vary based on the health of the target and variation in the raid DPS. This chart shows how often the duration of the encounter varied by how much time.

Waiting

This is the percentage of time in which no action can be taken other than autoattacks. This can be caused by resource starvation, lockouts, and timers.

Scale Factor Ranking

This row ranks the scale factors from highest to lowest, checking whether one scale factor is higher/lower than another with statistical significance.

TMI Range

This is the range of TMI values containing 95.00% of the data, roughly centered on the mean.

TMI/MSD Window

Window length used to calculate TMI and MSD, in seconds.

Max Spike Damage

Maximum amount of net damage taken in any N-second period (default 6sec), expressed as a percentage of max health. Calculated independently for each iteration. 'MSD Min/Mean/Max' are the lowest/average/highest MSDs out of all iterations.

Error

Estimator for the 95.00% confidence interval.

Range

This is the range of values containing 95.00% of the data, roughly centered on the mean.

Fight Length

Fight Length: 400.00
Vary Combat Length: 0.20

Fight Length is the specified average fight duration. If vary_combat_length is set, the fight length will vary by +/- that portion of the value. See Combat Length in the wiki for further details.